KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_06490Help
Entry
AU40_06490        CDS       T03761                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Pathway
senq00030  Pentose phosphate pathway
senq00480  Glutathione metabolism
senq01100  Metabolic pathways
senq01110  Biosynthesis of secondary metabolites
senq01120  Microbial metabolism in diverse environments
senq01130  Biosynthesis of antibiotics
senq01200  Carbon metabolism
Module
senq_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
senq_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
senq_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:senq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AU40_06490
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AU40_06490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senq04147]
    AU40_06490
Enzymes [BR:senq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AU40_06490
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AU40_06490
Exosome [BR:senq04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AU40_06490
  Exosomal proteins of colorectal cancer cells
   AU40_06490
  Exosomal proteins of bladder cancer cells
   AU40_06490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AHR18730
Position
1213240..1214715
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQIHPDTRIIGVGRADWDKEAYTH
VVREALETFMKEKIDEGLWDTLSGRLDFCNLDVNDTPAFSRLGDMLDQKNRTTINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSREINDRVGEYFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGQKVPG
YLEEEGANKSSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAMDNDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcccaggcatgtgacctggtcattttcggcgcgaaaggcgac
ctggcgcgccggaaactgctgccttccctgtatcagcttgagaaagccggccagatccat
ccggatacccgtatcattggggtggggcgcgcggactgggataaagaagcttatacccac
gtcgtgcgtgaggcgctggaaaccttcatgaaggaaaaaattgatgaaggcttgtgggat
acgctgagcggccgtctggatttttgtaatcttgacgttaacgatacgcctgcgtttagt
cgcctgggcgatatgctggatcaaaaaaaccgcaccaccattaactattttgcgatgccg
cccagcacctttggcgctatttgcaaagggttaggagaggctaaactcaacgccaaaccg
gcgcgcgtcgtgatggaaaaaccgttgggtacttcgctggcgacctcgcgtgagattaac
gatcgggtcggcgaatactttgaagagtgccaggtgtatcgtatcgaccactatctgggc
aaagaaacggttctcaacctgctggcgctgcgttttgccaactcgttattcgttaataac
tgggataaccgcactatcgatcacgttgagattaccgtagcggaagaggtggggattgaa
gggcgctggggatattttgaccaggccggtcagatgcgcgatatgatccagaaccacttg
ctgcaaattctctgcatgattgccatgtcaccgccgtctgacctgagcgccgacagtatt
cgcgatgaaaaagtcaaagtgttgaaatcgttgcgccgtattgatcgctccaacgtgcgt
gaaaaaacggttcgtggtcaatacaccgcgggctttgcgcagggtcaaaaggtgccgggc
tatctggaagaagagggcgcgaataaaagcagcaacaccgaaactttcgtcgcgatccgc
gtcgacatcgataactggcgttgggcgggcgtgccattctatctgcgcaccggcaagcgt
ctgccaaccaagtgctctgaagtcgtggtttatttcaagacgcctgaactgaatctcttt
aaagagtcctggcaagacctgccgcagaacaaattgacgattcgcctgcagccggatgaa
ggcgtagatattcaggtgcttaacaaagtaccggggctggatcataagcataatctgcag
atcacgaagcttgatctgagctactccgagacctttaatcagacgcacctggcggatgca
tatgagcgcctgctgctggaaacgatgcgtggcattcaggcgctgtttgtccgccgtgac
gaagtggaagaagcctggaagtgggtggactccattaccgaagcatgggcgatggacaac
gacgcgccgaagccgtatcaggcgggcacctggggaccggtagcgtccgtggcgatgatt
acccgtgacggtcgttcgtggaatgagtttgagtaa

DBGET integrated database retrieval system