KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_09845Help
Entry
AU40_09845        CDS       T03761                                 

Gene name
btuE
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Pathway
senq00480  Glutathione metabolism
senq00590  Arachidonic acid metabolism
senq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AU40_09845 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AU40_09845 (btuE)
Enzymes [BR:senq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AU40_09845 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: AHR19312
Position
complement(1808155..1808706)
Genome map
AA seq 183 aa AA seqDB search
MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVV
LGFPCNQFMGQEPGSEEEIKTYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVA
PEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQRFSPDMTPEDPIVMESIKIT
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactcgcttcttaatactcacgttacgacgattgatggagaggtcactacactt
gaaaaatacgccggaaaagtgctgctcattgtaaacgtcgcctccagatgtggcctgacg
ccgcaatatgaacagttggaaaatatccagaaggcgtgggcagatcaggggtttgtcgtg
ttgggttttccctgcaaccagtttatggggcaggagccaggcagcgaagaggagattaaa
acctattgtgccagcacctggggcgtcacgttcccgatgttcagtaaaattgatgtgaat
ggcgacgcgcgccatccgctgtatcaaaaactgatagccgctgcgccaacggcagtcgcg
ccggagaagagcggcttttacgaacggatggtaagcaaagggcgtacgccactctatccg
gatgatattctgtggaattttgaaaaatttttggtaggccgggatggtcaggtggtacag
cgtttttcgccggatatgacgcctgaagatcctattgtgatggaaagcataaaaatcacg
ttggcaaaataa

DBGET integrated database retrieval system