KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_16375Help
Entry
AU40_16375        CDS       T03761                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Pathway
senq00071  Fatty acid degradation
senq00280  Valine, leucine and isoleucine degradation
senq00310  Lysine degradation
senq00362  Benzoate degradation
senq00380  Tryptophan metabolism
senq00620  Pyruvate metabolism
senq00630  Glyoxylate and dicarboxylate metabolism
senq00640  Propanoate metabolism
senq00650  Butanoate metabolism
senq00900  Terpenoid backbone biosynthesis
senq01100  Metabolic pathways
senq01110  Biosynthesis of secondary metabolites
senq01120  Microbial metabolism in diverse environments
senq01130  Biosynthesis of antibiotics
senq01200  Carbon metabolism
senq01212  Fatty acid metabolism
senq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:senq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AU40_16375
   00630 Glyoxylate and dicarboxylate metabolism
    AU40_16375
   00640 Propanoate metabolism
    AU40_16375
   00650 Butanoate metabolism
    AU40_16375
  Lipid metabolism
   00071 Fatty acid degradation
    AU40_16375
   00072 Synthesis and degradation of ketone bodies
    AU40_16375
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AU40_16375
   00310 Lysine degradation
    AU40_16375
   00380 Tryptophan metabolism
    AU40_16375
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AU40_16375
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AU40_16375
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AU40_16375
Enzymes [BR:senq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AU40_16375
Exosome [BR:senq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AU40_16375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHR20427
Position
complement(3024646..3025824)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattactattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system