KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_20185Help
Entry
AU40_20185        CDS       T03761                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Pathway
senq00051  Fructose and mannose metabolism
senq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AU40_20185
Enzymes [BR:senq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AU40_20185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AHR21076
Position
3758685..3759848
Genome map
AA seq 387 aa AA seqDB search
MKVNTMKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENE
QVDTVSGVNAVSSIGDDVVDLIAHVDLITTAVGPVVLERIAPAIAKGLAKRKAQGVDAPL
NIIACENMVRGTTQLKGHVMNALADGDKAWVEQHVGFVDSAVDRIVPPSASATHDPLEVT
VETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTI
RDAILDESIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGR
QPLRKLSAGDRLIKPLLGTLEYGLPHVNLVKGIAAAMHFRSDEDPQAQELAALITEKGPQ
AALAQISGLDANSDVVAEAVNAYNATK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaatactatgaaagcattacattttggcgcaggtaatatcggtcgtggcttt
atcggcaaactgctggctgacgcggggatacaactgacgtttgcggatgtaaatcaggtc
gtactcgatgccctgaatgcccgtcatagctatcaggttcatgttgtgggtgaaaatgag
caggtggataccgtttccggcgtcaacgctgtcagcagcatcggcgatgatgttgtcgac
ctgattgcccacgttgatttaatcactactgccgtgggtccggttgtgcttgagcgtatc
gctccggccatcgctaaagggctggcaaaacgtaaggcgcagggcgtggatgccccgctg
aatatcatcgcctgtgaaaacatggtgcgcggcaccacacagctgaaaggccacgtaatg
aatgcgctggcggatggcgataaagcctgggttgaacagcacgtcggttttgtcgattcc
gccgttgaccgcatcgtgccgccatctgcttctgcgacccatgacccgctggaagtgacg
gtagaaaccttcagcgagtggatcgtcgataaaacccagtttaaaggcgcgttgccaaac
atcccggggatggagttaacggataacctgatggcatttgtcgaacgtaaactcttcacg
ctgaacacaggtcatgctataaccgcgtacctcggcaaattagccggtcatcaaaccatt
cgcgacgctattctcgatgagagtattcgcgcggtggtgaaaggcgcgatggaagaaagc
ggcgcggtgctgatcaaacgctacggttttgatgccgacaaacatgcggcatacattcag
aaaatcctcggtcgttttgaaaacccgtatctgaaagatgacgtcgaacgcgtaggtcgt
cagccgctacgcaaactcagcgcgggcgaccgtctgatcaaaccgctgcttggcaccctg
gaatatggtctgccgcatgtgaatctggtcaaagggatcgcggcggcgatgcatttccgt
agcgatgaagatccgcaggcgcaagagttggcggcactgattaccgaaaaaggcccgcag
gccgcgctggcgcaaatttccgggctggatgccaatagcgatgtggtggcggaggcggtt
aacgcatataacgcgaccaaatga

DBGET integrated database retrieval system