KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_24345Help
Entry
AU40_24345        CDS       T03761                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Pathway
senq00220  Arginine biosynthesis
senq01100  Metabolic pathways
senq01110  Biosynthesis of secondary metabolites
senq01130  Biosynthesis of antibiotics
senq01230  Biosynthesis of amino acids
Module
senq_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:senq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AU40_24345
Enzymes [BR:senq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     AU40_24345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AHR21768
Structure
PDB: 

Position
complement(4546828..4547832)
Genome map
AA seq 334 aa AA seqDB search
MSTFYQKPFLKLLDFTASELTALLQLAAKLKADKKNGKEEQKLVGKNIALIFEKDSTRTR
CSFEVAAYDQGARVTYLGSSGSQIGHKESIKDTARVLGRMFDGIQYRGYGQEIVETLAEY
SGVPVWNGLTDEYHPTQLLADLLTMQEHLPGKAFNEMTLVYAGDARNNMGNSMLEAAALT
GLDLRLVAPKACWPQAALVAECSAMAKKNGGAITLTEDIASGVKGADFIYTDVWVSMGEP
KEKWAERIALLRDYQVNSQMMALTGNPQVKFLHCLPAFHDDETTLGKKMAEEYGLHGGME
VTDEVFESAASIVFDEAENRMHTIKAVMVATLSK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgttttaccaaaaaccttttttaaagttacttgatttcaccgccagcgagctc
actgctctgttgcagcttgccgccaaactgaaagccgataagaaaaacggtaaagaagaa
caaaagctggtgggtaagaatattgcgctcatcttcgaaaaagactcgacccggacacga
tgctctttcgaagttgccgcatacgatcagggggcgcgcgtgacgtacctgggttccagc
gggagccagatcggccataaagagtccatcaaagatactgcccgcgtcctgggccggatg
tttgacggtattcagtatcgaggatatggccaggagatcgtcgaaacgctggctgaatat
tccggtgtgccggtatggaacggtttaaccgatgagtatcacccaacgcaattactggcg
gatctgctcaccatgcaggaacatctgccgggtaaagcctttaacgagatgacgttggtc
tatgccggagacgcgcgtaataacatgggtaactccatgctggaagccgccgcgttaaca
ggattggatctccgtctggtcgcgccaaaagcctgctggccgcaagccgcgttagtggcg
gagtgcagcgccatggcgaaaaagaacggcggcgccatcaccctgaccgaagatatcgcc
tcaggcgtaaaaggcgcggattttatctataccgatgtttgggtctctatgggcgaaccc
aaagagaaatgggcggagcgtattgccctgctgcgtgattatcaggtcaacagccagatg
atggcgttaaccggcaatccgcaggttaagttcctgcattgtctgcctgcgttccatgat
gacgaaaccacgctcggcaaaaaaatggccgaagagtacggtttacatggcgggatggag
gtgaccgacgaggtttttgagtctgcggccagcattgtctttgatgaagcggaaaaccgc
atgcataccatcaaagcagtaatggtagcgacgctgtctaaataa

DBGET integrated database retrieval system