KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT2: STMDT2_06221Help
Entry
STMDT2_06221      CDS       T02869                                 

Definition
(GenBank) possible hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
senr  Salmonella enterica subsp. enterica serovar Typhimurium DT2
Brite
KEGG Orthology (KO) [BR:senr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STMDT2_06221
Enzymes [BR:senr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     STMDT2_06221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: CDG06780
Position
693638..694426
Genome map
AA seq 262 aa AA seqDB search
MFVAAGQFVVSSVWEENAQVCVSLMAQAAGRGVSLLVLPEGILARDDIDLDLPIRAAQPL
DGAFMTRLLEESAHNNMTTIFTILVPSTPGRAVNMLVALRAGHIVARYAKLHLYDAFSMQ
ESQSIDAGTVIAPVLDVEGVKVGLMTCYDLRFPDMALALALQGADVLALPTGWVRGPLKE
QQWSTLLAARALDTTSYMIAAGECGNRNIGQSRIIDPLGVTIAAAADRPALIVAEIFRER
IDQVREQLPLLQQRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttgcagccgggcagtttgtggtgagttctgtatgggaagagaatgcgcaagtt
tgcgtttcgttaatggctcaggcggcgggccgcggcgtatcgcttctggtgttgcctgag
gggatattagcgcgagatgacatcgaccttgacctgccgattcgcgccgcgcagccgctg
gatggcgcgtttatgacgcggcttctggaagaaagcgctcataataatatgacgacgata
ttcactatccttgtcccgtcaacgcctggacgggcggttaatatgctggtggcgctacgg
gcgggtcacattgtcgcgcgttacgcgaagctgcatctctatgatgcgttttcgatgcaa
gaatcccaaagtattgatgccggaaccgttatcgcgcctgtgctggacgtggagggggtt
aaggtggggcttatgacctgttatgacctgcgctttccggacatggcgctagcgctggct
ttacagggggctgacgtattggcgctgccgacgggctgggttcgcggcccgttgaaagag
cagcagtggtcgacgctgctggcggcgagagcgctggataccaccagctatatgattgcg
gccggggagtgtggtaatcgtaatattggtcaaagtcgtattatcgatccgttgggggta
acgatagccgcggcagccgatcgtccggcgctgatcgtcgcggaaatattcagagaacga
atagaccaggtgcgggagcaacttcctcttttgcagcaacgacgatttgcgccaccgcaa
ttattatga

DBGET integrated database retrieval system