KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_11615Help
Entry
Q786_11615        CDS       T02944                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sens00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Q786_11615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sens02000]
    Q786_11615
Transporters [BR:sens02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Q786_11615
   Histidine transporter
    Q786_11615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 MFS_Mycoplasma
Motif
Other DBs
NCBI-ProteinID: AHB45004
Position
complement(2424231..2424917)
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRITGLIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacgggttttcaggcgtaattttacagggcgcgatcgtcacgctggaactggcg
ctcagttccgtggtgctggccgtgcttattggtcttgtcggcgcgggggcgaagctttcg
caaaaccggataacggggcttatttttgaaggatacaccaccctgattcgcggggtgccg
gatctggtcttaatgctgctgatattttacggattgcaaatcgcgcttaacgtggtgacc
gattcgctgggtatcgaccagatagatattgatccgatggtggccggtattatcaccctt
ggtttcatctacggcgcctattttaccgaaacctttcgcggcgcgtttatggcggtgccg
aaaggccatatcgaggcggcgacggcttttggttttacccacgggcaaaccttccggcgg
attatgttcccggcgatgatgcgttacgccctgccggggatcggcaataactggcaggtg
atactcaaagcgacggcgctggtgtcgctgctgggcctggaagatgtcgtcaaagccacg
cagcttgccggtaaaagcacctgggagcctttctattttgctgtggtctgtggacttatc
tacctggtattcaccaccgtttccaatggtgtgctgctcttacttgagcgtcgctattcc
gtgggcgtgaagagggccgatttgtga

DBGET integrated database retrieval system