KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_16935Help
Entry
Q786_16935        CDS       T02944                                 

Definition
(GenBank) peptidyl-prolyl cis-trans isomerase
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:sens00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Q786_16935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sens03110]
    Q786_16935
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sens04147]
    Q786_16935
Enzymes [BR:sens01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Q786_16935
Chaperones and folding catalysts [BR:sens03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Q786_16935
Exosome [BR:sens04147]
 Exosomal proteins
  Proteins found in most exosomes
   Q786_16935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-ProteinID: AHB46003
Position
complement(3502859..3503431)
Genome map
AA seq 190 aa AA seqDB search
MLKSTLAAVAAVFALSALSPAALAAKGDPHVLLTTSAGNIELELNSQKAPVSVKNFVDYV
NSGFYNNTTFHRVIPGFMIQGGGFNEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADK
DSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPTKP
VVILSAKVLP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaatcgactctggcggctgtcgcagctgttttcgctctttctgctctttctccc
gcagcgttggcagcaaaaggcgatcctcatgtgctgttaaccacctccgccgggaatatt
gagctggagctgaacagccagaaagcgccggtttctgtgaaaaactttgtcgattacgtc
aacagtggtttctataacaacactacgtttcaccgcgttattcctggctttatgattcag
ggcggtggttttaacgagcagatgcagcagaagaaaccgaatccgccgattaagaatgaa
gccgacaacggcctgcgtaatactcgcggcacgatcgcgatggcgcgcaccgcagataaa
gatagcgccaccagccagttctttattaacgtcgcggataacgcttttctcgaccacggc
cagcgcgactttggctatgcggtatttggtaaagtggtaaaaggtatggatgtcgccgat
aaaatctcacaggtaccgacgcacgatgtcgggccttatcagaatgtgccgacaaaacca
gtcgttatcctttccgcgaaagtcctgccataa

DBGET integrated database retrieval system