KEGG   Salmonella enterica subsp. enterica serovar Agona 24249: Q786_22575Help
Entry
Q786_22575        CDS       T02944                                 

Definition
(GenBank) dUMP phosphatase
  KO
K08723  5'-nucleotidase [EC:3.1.3.5]
Organism
sens  Salmonella enterica subsp. enterica serovar Agona 24249
Pathway
sens00230  Purine metabolism
sens00240  Pyrimidine metabolism
sens00760  Nicotinate and nicotinamide metabolism
sens01100  Metabolic pathways
sens01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sens00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Q786_22575
   00240 Pyrimidine metabolism
    Q786_22575
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Q786_22575
Enzymes [BR:sens01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Q786_22575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: AHB47044
Position
4718529..4719206
Genome map
AA seq 225 aa AA seqDB search
MKWDWIFFDADETLFTFDSFTGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGAITS
LQLQHARFQSWAERLNVAPGLLNDAFISAMAEICSPLPGAVSLLNAIRGQAKIGIITNGF
TALQQTRLERTGLREYFDLLVISEQVGVAKPDPKIFNYALEQAGNPDRSRVLMVGDTAES
DILGGINAGLSTCWLNAHHREQPAGIHPTWTVASLSELEQLLCKH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgggactggattttctttgatgccgatgaaacgctgtttacgtttgattctttc
accggcttacagcggatgttccttgactatagcgtcacctttaccgctgaggatttccag
gattaccaggccgtgaataagccgctatgggtggattatcagaacggcgcgattacctca
ttacaattgcagcacgcgcgctttcaaagttgggctgaacggctaaacgttgcgccgggg
ctgctgaatgacgcttttattagtgcgatggcggagatctgttctcctttgccgggcgcc
gtttcgctacttaatgcgattcgcgggcaggctaaaatcggtattattactaacggtttt
accgcgctacaacaaactcgtctggagcgcaccgggctgcgtgagtatttcgatctgctg
gtgatttccgagcaggttggcgtcgcgaagcccgatccgaaaatctttaactacgccctg
gagcaggcggggaatcctgaccgctcgcgcgtattaatggttggcgataccgcggagtcc
gatattcttggcggcattaacgccggactgtcgacctgctggcttaacgcgcatcatcgc
gagcagcccgcgggtattcatccaacctggactgtggcgtcattaagcgaactggagcag
ctcctgtgtaaacactga

DBGET integrated database retrieval system