KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_00295Help
Entry
TY21A_00295       CDS       T02648                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
sent00620  Pyruvate metabolism
sent01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sent00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TY21A_00295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sent02000]
    TY21A_00295
Enzymes [BR:sent01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     TY21A_00295
Transporters [BR:sent02000]
 Other transporters
  Primary active transporters [TC:3]
   TY21A_00295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AGK65689
Position
complement(64859..66634)
Genome map
AA seq 591 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAQLDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAFELVSEIKKRFEVRLHLHCHATTGMAEMALLKAIEADVDGVDTAISSMSATYGHPA
TEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEGQLKGYDSRILVAQVPGGML
TNLESQLKQQNAADRLDQVLAKIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLEGSAPVTCRPADLLKPELAELEADVRRQAQEK
GITLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPLPQAEAAQPVAKAEKPAASGIYT
VEVEGKAFVVRVSDGGDISQLTTAVPAASSAPVQAAAPAGAGTPVTAPLAGNIWKVIATE
GQSVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVSVGDTLMTLA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgactattgccattaccgacgtcgtcctgcgtgacgcccaccagtctctgttcgccacc
cgcctgcgccttgacgatatgctgccgattgccgctcagctcgacgacgtgggctacggc
tcgctggagtgctggggcggcgccacctttgacgcctgtattcgttttctcggcgaagac
ccgtggctgcgcctgcgcgaactcaaaaaagccatgcccaaaaccccgctgcagatgctg
ctgcgcggccagaacctgctcggctaccgccactacgccgatgatgtggtggagcgcttc
gttgaacgcgcggtgaaaaacggcatggatgtgttccgcgtcttcgatgccatgaacgac
ccgcgcaatatgaaagccgccctgcaggcggtgcgcagccacggcgcgcacgcccagggg
acgctctcctacaccaccagcccggcgcacaccctgcagacctggctggacctgaccgaa
cagttgttagagaccggcgttgactcgattgccatcaaggatatgtccggcattctcacg
ccgatggccgcttttgagctggtgagcgaaatcaaaaaacgttttgaggtgcgcctgcac
ctgcactgtcacgccaccaccgggatggcggagatggccctgctgaaggctatcgaggcg
gatgttgacggcgtggacacggcgatttcgtccatgagcgccacctacggccacccggcc
accgaggcgctggtggcgacgttggcaggtactgagcacgacaccgggctggatatcctg
aagctggaaaatatcgccgcgtacttccgcgaggtgcgcaaaaagtaccatgcctttgaa
ggccagctgaaaggctacgacagccgtattctggtggcgcaggtaccgggcgggatgctg
accaacctcgaaagccagctgaagcagcagaacgcggcggacaggctggaccaggtgctg
gcgaaaatcccccgcgtgcgcgaggacctcggctttatcccgctggtcaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtcctgaccggcgaacgctacaaaaccatc
gcgaaggaaaccgccggcattctgaaaggcgaatacggccacaccccggtgccggttaac
gccgcgttacaggcccgcgtgctggaagggagcgctccggtgacctgccgcccggcggac
ctgctgaagccggagctggctgaactggaagcggacgtcaggcgccaggcgcaggagaag
gggattactctggcgggaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
atcggcctcaaattccttgagaaccgccataacccggcggcgtttgagccactgccgcag
gcggaagccgcgcagccggtggcaaaagcagagaagcctgccgcctccggtatctacacc
gtggaagtggaaggcaaagcctttgtggtgagggtcagcgacggcggcgatatcagccag
cttactacggctgttccggcggcctcttccgcaccggttcaggctgccgccccggcaggc
gccggcaccccggtcaccgcgccgctggcgggcaacatctggaaggtgattgccaccgaa
ggccagagcgtggccgaaggcgacgtgctgctgattctggaagccatgaagatggaaacc
gaaatccgcgccgcgcaggccggcaccgtccgcggtatcgcggtgaagtccggggacgcc
gtctccgtgggcgacaccctgatgacgctggcgtaa

DBGET integrated database retrieval system