KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_18180Help
Entry
TY21A_18180       CDS       T02648                                 

Definition
(GenBank) phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
sent00010  Glycolysis / Gluconeogenesis
sent01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sent00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TY21A_18180
Enzymes [BR:sent01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     TY21A_18180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD AdoMet_dc PNK3P
Motif
Other DBs
NCBI-ProteinID: AGK69105
Position
complement(3693640..3694239)
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGVWSDLSRVPLASLKQKFTMGETFHQHERGEITDEAFAEA
FCHEMALSLSYEQFAHGWQAVFVGLRPEVIAIMHKLREQGHRVVVLSNTNRLHTHFWPEE
YPEVRAAADHIYLSQDLGMRKPEARIYQHVLQKEGFSAADAVFFDDNADNIEGANQLGIT
SILVKDKATIPDYFAKLLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctacatctttgatttaggtaatgtgattgtcgatatcgactttaaccgcgtatta
ggtgtgtggagcgacctgagtcgagtaccgttggcttcgctgaagcaaaaatttacgatg
ggcgagacttttcaccaacatgaacgcggtgagataacggacgaagcgtttgctgaagct
ttctgtcatgaaatggcgttatcgctcagttatgaacaatttgcgcacggctggcaggcg
gtatttgtcggattacggcccgaagtgattgctatcatgcataaactgcgcgagcagggg
catcgcgtggtggtgttatccaatactaaccgactgcatacccacttctggccggaggaa
tacccggaggtgcgcgctgccgccgaccatatctatttatcgcaggatttgggaatgcgt
aaaccggaagcgcgtatttatcagcacgtcctgcagaaagaaggtttttccgctgccgat
gcggtctttttcgacgacaatgccgataatatagaaggggccaaccagttggggatcacc
agcattctggtgaaggataaagccaccatccctgactatttcgcgaagctgttatgctaa

DBGET integrated database retrieval system