KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_00445Help
Entry
AU39_00445        CDS       T03760                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Brite
KEGG Orthology (KO) [BR:senv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AU39_00445 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AHP76841
Position
complement(101852..102229)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtgcaaagcgtctacattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtaaccatccgcaatctgggccgg
gcgccagtgcagctattgggccgctactggctgattaccaatggtcatggccgtgaaacc
gaagtccagggcgaaggtgtggttggcgtccagccgcgcattgcgcctggcgaagagtat
cagtacaccagcggcgcggtaattgaaacgccgctgggcaccatgcagggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacattcccgtgtttcgactcgccgtc
cctacactcattcactaa

DBGET integrated database retrieval system