KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_10190Help
Entry
AU39_10190        CDS       T03760                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00860  Porphyrin and chlorophyll metabolism
senv01100  Metabolic pathways
Module
senv_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AU39_10190
Enzymes [BR:senv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AU39_10190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase SNO Peptidase_S51 Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AHP78673
Position
complement(2103092..2104612)
Genome map
AA seq 506 aa AA seqDB search
MTQAVMLQGTASDVGKSVLAAGLCRIFYQDGLRTAPFKSQNMALNSGITSDGKEMGRAQI
FQAEAAGITPDVRMNPVLLKPTSDRQAQVVLMGKVATNMDAVSYHDYKPRLREQILAVYN
SLAQEYDVIVLEGAGSPAEINLRDRDIVNMGMAEMAQCPVILVADIDRGGVFAAIYGTLA
LLHKQERDRVKGVIINKFRGDVALLYSGIEQIESLTGVPVLGVMPWLDVDLEDEDGVALQ
NDKYRGNAPRDITIAIVQLPHISNFTDFNALAAQPDVRIRYIRRPEALTDADLVILPGSK
NTLSDLAWLRESGMADALLQTHRQGVPVMGICGGYQMLGDTIVDEVESGLGTQPGLGLLN
TITRFAQDKITTQVNATMSGELPSWLAAAAGLPVRGYEIHMGETVLQEGCCTAMTLQKNG
CSVADGAVTADGLAFGTYLHGLFDSDAFTRAVVNGLRARKGLAPWETTFCYAEHKARQFD
LLAEAMRQHIDIDKIYTIMQQHQEPV
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcagttatgttgcaggggacggcatccgacgtcggcaaaagtgtgctggcg
gcgggtttatgccgcattttttatcaggatggtctgcgtaccgcgccgtttaaatcgcaa
aatatggcgcttaattctggtattacgtcggatggtaaagagatggggcgggcgcagatt
tttcaggcggaagccgcggggatcacgccagatgtgcgtatgaacccggtgctgctcaaa
ccgaccagcgatcgccaggcgcaggtcgtgctgatggggaaagtggcgaccaatatggat
gcggtgagttaccatgactataaaccgcgtttgcgtgagcaaatccttgcggtctataac
agcctggcgcaggaatatgacgttattgtgctggaaggcgccggaagcccggcggaaatc
aatctgcgcgatcgcgatatcgtcaatatgggaatggcggaaatggcccagtgtccggtt
attctggtggcggatatcgaccgaggcggcgtattcgccgctatttatggcacgctggcg
ctgctgcataaacaggagcgtgacagagtaaagggcgtcattatcaacaaattccgcggc
gacgtggcgctactctattccggtatcgaacaaatcgaatcgcttaccggcgtcccggtc
ctgggagtgatgccgtggctggatgtggatctggaagatgaagatggcgtcgcgctgcaa
aacgataaatatcgcggtaacgccccccgtgatatcactattgccattgtgcaactgcca
catatttctaactttacggattttaacgctctggcggcgcagccggatgtgcgcatacgc
tatattcgccgcccggaagcgttgactgacgctgatctggtgatcctgccgggcagtaag
aatacgctgagcgacctcgcctggctgcgcgaaagcgggatggcggatgcgctattgcag
acacatcggcagggcgtgccggtgatgggaatttgcggtggctaccagatgctgggcgac
actattgtggatgaggtggagtcggggctgggtacgcagccgggcctggggctgcttaat
acgatcactcgctttgcacaggataaaatcacgacgcaggttaacgcgacaatgtcaggc
gagctgcccagctggctggctgccgcggcggggctaccggtacgcggttatgaaatccac
atgggggaaacggtgctgcaggaaggatgctgtacggccatgacgttacagaaaaatgga
tgctctgtggcggatggcgcggtcaccgccgacggactggcgtttggcacttaccttcac
ggcctgtttgacagcgatgcgtttacccgtgcggtggtcaatgggttacgggcacgaaaa
gggcttgcgccgtgggaaacgactttttgttatgcggagcataaagcgcggcaatttgat
ctgctggcggaagcgatgcggcaacatattgatattgataaaatttataccatcatgcaa
cagcatcaggagccggtatga

DBGET integrated database retrieval system