KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_11810Help
Entry
AU39_11810        CDS       T03760                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:senv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AU39_11810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:senv02000]
    AU39_11810
Enzymes [BR:senv01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     AU39_11810
Transporters [BR:senv02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AU39_11810
   Histidine transporter
    AU39_11810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 ABC_ATPase AAA_13 AAA_16 AAA_23 G-alpha PRK AAA_33 cobW RsgA_GTPase AAA_24 NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: AHP78985
Structure
PDB: 

Position
complement(2456197..2456970)
Genome map
AA seq 257 aa AA seqDB search
MSENKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
AIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVF
GNPQSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaataaattacacgttatcgatttgcacaaacgctacggcggtcatgaagtg
ctgaaaggggtatcgttgcaggcccgcgccggagatgtgattagcatcatcggctcgtcc
ggctccggtaaaagcacttttttgcgctgtattaacttcctcgaaaaaccgagcgaaggc
gcgattatcgtgaacggtcagaacattaatctggtgcgcgacaaagacgggcagctcaaa
gtggcggataaaaatcagctacgcttgttgcgtacccgcctgacgatggtgtttcagcac
tttaacctctggagccacatgacggtgctggaaaatgtgatggaagcgccgattcaggta
ctgggattaagcaagcacgacgcgcgcgagcgggcgttgaaatatctggcgaaggtgggg
attgatgagcgcgctcagggcaaatatcccgtccatctctccggcggccaacagcagcgc
gtttctattgcgcgcgcgctggcgatggaacctgacgttttactgttcgatgaacccaca
tcggcgctcgatcctgaactggtcggcgaagtgttgcgcatcatgcaacaactggcggaa
gaaggcaaaacgatggtggtggtcacgcatgaaatgggcttcgcccgccatgtctcttcg
cacgttatttttctgcatcaggggaaaattgaagaagagggcgatccggagcaggtgttc
ggcaatccgcaaagcccgcgtttacagcaattcctgaaaggctcgctgaaataa

DBGET integrated database retrieval system