KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_14545Help
Entry
AU39_14545        CDS       T03760                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00071  Fatty acid degradation
senv00280  Valine, leucine and isoleucine degradation
senv00310  Lysine degradation
senv00362  Benzoate degradation
senv00380  Tryptophan metabolism
senv00620  Pyruvate metabolism
senv00630  Glyoxylate and dicarboxylate metabolism
senv00640  Propanoate metabolism
senv00650  Butanoate metabolism
senv00900  Terpenoid backbone biosynthesis
senv01100  Metabolic pathways
senv01110  Biosynthesis of secondary metabolites
senv01120  Microbial metabolism in diverse environments
senv01130  Biosynthesis of antibiotics
senv01200  Carbon metabolism
senv01212  Fatty acid metabolism
senv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AU39_14545
   00630 Glyoxylate and dicarboxylate metabolism
    AU39_14545
   00640 Propanoate metabolism
    AU39_14545
   00650 Butanoate metabolism
    AU39_14545
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AU39_14545
   00072 Synthesis and degradation of ketone bodies
    AU39_14545
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AU39_14545
   00310 Lysine degradation
    AU39_14545
   00380 Tryptophan metabolism
    AU39_14545
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AU39_14545
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AU39_14545
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AU39_14545
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senv04147]
    AU39_14545
Enzymes [BR:senv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AU39_14545
Exosome [BR:senv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AU39_14545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHP79506
Position
complement(3068345..3069523)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattactattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system