KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_18115Help
Entry
AU39_18115        CDS       T03760                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00051  Fructose and mannose metabolism
senv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AU39_18115
Enzymes [BR:senv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AU39_18115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AHP80186
Position
3758691..3759854
Genome map
AA seq 387 aa AA seqDB search
MKVNTMKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENE
QVDTVSGVNAVSSIGDDVVDLIAHVDLITTAVGPVVLERIAPAIAKGLAKRKAQGVDAPL
NIIACENMVRGTTQLKGHVMNALADGDKAWVEQHVGFVDSAVDRIVPPSASATHDPLEVT
VETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTI
RDAILDESIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGR
QPLRKLSAGDRLIKPLLGTLEYGLPHVNLVKGIAAAMHFRSDEDPQAQELAALITEKGPQ
AALAQISGLDANSDVVAEAVNAYNATK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaatactatgaaagcattacattttggcgcaggtaatatcggtcgtggcttt
atcggcaaactgctggctgacgcggggatacaactgacgtttgcggatgtaaatcaggtc
gtactcgatgccctgaatgcccgtcatagctatcaggttcatgttgtgggtgaaaatgag
caggtggataccgtttccggcgtcaacgctgtcagcagcatcggcgatgatgttgtcgac
ctgattgcccacgttgatttaatcactactgccgtgggtccggttgtgcttgagcgtatc
gctccggccatcgctaaagggctggcaaaacgtaaggcgcagggcgtggatgccccgctg
aatatcatcgcctgtgaaaacatggtgcgcggcaccacacagctgaaaggccacgtaatg
aatgcgctggcggatggcgataaagcctgggttgaacagcacgtcggttttgtcgattcc
gccgttgaccgcatcgtgccgccatctgcttctgcgacccatgacccgctggaagtgacg
gtagaaaccttcagcgagtggatcgtcgataaaacccagtttaaaggcgcgttgccaaac
atcccggggatggagttaacggataacctgatggcatttgtcgaacgtaaactcttcacg
ctgaacacaggtcatgctataaccgcgtacctcggcaaattagccggtcatcaaaccatt
cgcgacgctattctcgatgagagtattcgcgcggtggtgaaaggcgcgatggaagaaagc
ggcgcggtgctgatcaaacgctacggttttgatgccgacaaacatgcggcatacattcag
aaaatcctcggtcgttttgaaaacccgtatctgaaagatgacgtcgaacgcgtaggtcgt
cagccgctacgcaaactcagcgcgggcgaccgtctgatcaaaccgctgcttggcaccctg
gaatatggtctgccgcatgtgaatctggtcaaagggatcgcggcggcgatgcatttccgt
agcgatgaagatccgcaggcgcaagagttggcggcactgattaccgaaaaaggcccgcag
gccgcgctggcgcaaatttccgggctggatgccaatagcgatgtggtggcggaggcggtt
aacgcatataacgcgaccaaatga

DBGET integrated database retrieval system