KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090332: AU39_20140Help
Entry
AU39_20140        CDS       T03760                                 

Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
senv  Salmonella enterica subsp. enterica serovar Enteritidis EC20090332
Pathway
senv00270  Cysteine and methionine metabolism
senv00450  Selenocompound metabolism
senv00920  Sulfur metabolism
senv01100  Metabolic pathways
senv01110  Biosynthesis of secondary metabolites
senv01130  Biosynthesis of antibiotics
senv01230  Biosynthesis of amino acids
Module
senv_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:senv00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AU39_20140
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AU39_20140
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AU39_20140
Enzymes [BR:senv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     AU39_20140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHP80559
Position
4177892..4179052
Genome map
AA seq 386 aa AA seqDB search
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLATRGCYRVR
FVDQGDERALQAALEEKPKLVLVESPSNPLLRVVDIAKICRLAREAGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPEVVTELAWWANNIGVTGGAFDSYL
LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAML
SFELDGDEETLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMSPQARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANKG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtaaacaggccactatcgcagtgcgtagcggattaaacgatgacgaacaatac
ggctgcgttgtgccgccaatccatctctccagtacctataactttaccggtttcaatgag
ccgcgcgcgcatgattattcccgccgcggtaatcccacgcgtgatgttgttcagcgcgca
ttagcggaactggaaggcggcgcgggcgcggtattgacgaataccggcatgtcggcgatt
catctggtcaccaccgttttcctcaagccgggcgatctgctggtcgcgccgcatgattgc
tatggcggcagttatcgtctgtttgacagtctggcgacacgcggctgttatcgtgtgcgg
tttgtcgatcagggcgatgaacgcgccttacaggcggcgctggaagaaaaaccgaagctg
gtactggtagaaagtccaagtaatccattgttacgcgtggtggatattgcgaaaatctgt
cggctggcgcgcgaggcgggcgcagtgagcgtcgttgataacacgtttttaagcccggcg
ctgcaaaatccgctggcgttgggtgccgatctggtgttgcattcatgcacgaaatatctc
aacggtcattcggatgtcgtggccggcgtggtgattgcgaaagatccggaagtggtcact
gaactggcgtggtgggcgaataatattggcgtgaccggcggggcgtttgatagctatctg
ctgctgcgcggtttgcgaactctggtgccgcgtatggagctggcgcagcgcaacgcgcag
gcgattgtgaaatatctgcaaacccagccgttggtgaaaaaactgtatcacccgtcgctg
ccggaaaatcaggggcatgaaattgccgcgcgccagcaaaaaggctttggcgcaatgttg
agttttgaactggatggggatgaggagacgctgcgtcgttttctgggcgggctgtcgctg
tttacgctggcggaatctttagggggagtggaaagtttgatctctcacgccgccaccatg
acgcatgccggtatgtcgccgcaggcgcgtgccgccgccgggatctccgaaacgctactg
cgtatctccaccggtattgaagatggcgaagatttaattgccgacctggaaaatggcttc
cgggctgcaaacaaggggtaa

DBGET integrated database retrieval system