KEGG   Sodalis endosymbiont of Henestaris halophilus: HBA_0284Help
Entry
HBA_0284          CDS       T05311                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
seny  Sodalis endosymbiont of Henestaris halophilus
Brite
KEGG Orthology (KO) [BR:seny00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    HBA_0284 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: SNC58551
UniProt: A0A2C8CYA2
Position
I:463540..463917
Genome map
AA seq 125 aa AA seqDB search
MINSPRICVQVQSMYIETQSQPEKKRYVFAYTIRLRNLGRYSVQLLGRYWRITNANGQEI
EVQGEGVLGEKPCILPRGEFQYTSGAVLETPLGTMQGYYNMVNYQGQGFQVAIPVFRLAI
PSLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaactcgcctcgtatctgcgttcaggttcagagcatgtacatagagacacaatct
caaccagaaaagaaacgttacgtttttgcttataccattaggttgcgtaatttaggacgg
tattccgtgcagttactagggcgttactggcgtataaccaatgccaacggccaggaaatc
gaagttcaaggtgaaggtgtgttgggcgagaagccatgcattcttcccagaggcgagttt
caatacaccagtggtgcggtgttagaaactccacttggtaccatgcagggttattataat
atggtcaattatcagggacaagggtttcaagttgcgatcccggttttccgcttagcgatt
ccttctcttataaattaa

DBGET integrated database retrieval system