KEGG   Sodalis endosymbiont of Henestaris halophilus: HBA_0599Help
Entry
HBA_0599          CDS       T05311                                 

Gene name
ackA
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
seny  Sodalis endosymbiont of Henestaris halophilus
Pathway
seny00430  Taurine and hypotaurine metabolism
seny00620  Pyruvate metabolism
seny00640  Propanoate metabolism
seny00680  Methane metabolism
seny01100  Metabolic pathways
seny01120  Microbial metabolism in diverse environments
seny01200  Carbon metabolism
Module
seny_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:seny00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HBA_0599 (ackA)
   00640 Propanoate metabolism
    HBA_0599 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    HBA_0599 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HBA_0599 (ackA)
Enzymes [BR:seny01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     HBA_0599 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: SNC58842
UniProt: A0A2C8CXL6
Position
I:1011123..1012325
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDATNGEEHLSGLAECFNLPEVCIKWKIDGAKQASSLGAN
VAHSEALHFIVHNILAQKPELSTQLTAIGHRIVHGGEHFTQSAIINDDVLKGIEDSIPFA
PLHNPAHLIGIREALKKFPQLSQKNVAVFDTALHQTMPEESYLYALPYSLYQEHAIRRYG
AHGTSHFYVSREAAKMLHKPVDQLNVITCHLGNGGSVAAIRNGQCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDDLGFSVSRIKTMLTKESGLLGLTNITSDCRYVEDNYRDKSDAL
RAMNVYCHRLAKYIGSYSALMDGRLDAVIFTGGIGENAAMVRELSLRKLALLNFEVDPER
NFAARFGRAGVITTASSRPAIVIPTNEELVIAQDAARLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagctagtacttgttcttaactgtggcagttcatctttgaaattcgctatt
atcgatgccactaatggtgaagaacatctttccggtctcgctgaatgttttaatctaccg
gaagtgtgtattaaatggaagatagacggtgccaagcaagcatcgtctttgggtgctaat
gtcgcgcacagtgaagcactgcactttatagtgcataatattttagcacaaaaaccggaa
ctctccacacaattaaccgctatcggtcatcgcattgtgcacggcggtgaacattttacc
cagtctgccatcatcaatgatgacgtattaaaaggcatcgaggattctattccgtttgcg
ccgttgcataatccggcacaccttataggtattcgagaagctttgaaaaagtttcctcag
ttgtcacaaaagaacgtagcggtttttgataccgccttacatcaaacaatgcccgaagaa
tcatatctttatgctttgccatactctttatatcaagaacatgcaatccgccgctacggc
gcccacggtaccagccatttttatgttagccgcgaagcggctaagatgcttcacaaaccg
gttgatcaacttaatgtcatcacctgccatttaggcaatggtggctctgttgccgccatc
cgcaatggtcagtgtgtagatacgtctatggggctaaccccactagaaggtttagtcatg
ggaactcgtagcggcgatattgacccggctattatctttcatttacatgatgatttagga
ttttccgtatctagaatcaagaccatgttgaccaaagagtccggtctgttaggcttgact
aacataaccagcgactgccgttatgttgaagacaactaccgtgataaatccgacgccctc
cgcgccatgaatgtttattgccatcgtttagcaaaatacattggttcctatagcgcctta
atggacggacggctagatgcagtaattttcactggcggtattggcgaaaacgctgcgatg
gtgcgcgagctctcattgagaaaactcgcgctgcttaactttgaggtggatcctgaacgc
aattttgccgcacgtttcggccgtgctggtgtaatcacaaccgcatccagccgtccggcc
atcgtcattcctaccaatgaggagttagtcattgcccaagacgccgctcgtctgactgcg
taa

DBGET integrated database retrieval system