KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_0320
Entry
STM14_0320        CDS       T01714                                 

Definition
(GenBank) putative cytoplasmic protein
  KO
K11901  type VI secretion system protein ImpB
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Brite
KEGG Orthology (KO) [BR:seo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seo02044]
    STM14_0320
Secretion system [BR:seo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STM14_0320
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACY86846
UniProt: A0A0F6AX74
Position
314633..315175
AA seq 180 aa
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDR
KFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALN
QLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLANAPKSAATQQDVSADNESAE
NT seq 543 nt   +upstreamnt  +downstreamnt
atggctatcaacaatagcgcgcagaaattcatcgcgcgcaaccgcgcgccgcgcgtgcag
attgaatatgacgtagagatttacggttccgagaaaaaaatcgagctgccgttcgtgatg
gcggtgctggccgatctggccgggaaaccgcgtgaagaactgccgccggtgacggatcgc
aaattcctcgatattgatattgataacttcaatgagcgcatgaaagccattgcgccgcgc
gtggcgttcgctgtgccgaatacgctgacgggtgaaggtcagttgatggtcgatatcacg
ctggaaaatatggacgacttttcgccggcacagattgcccgcaaggtggacgccctgaac
cagttactggaagcccgcactcaactggcgaacctccagacctacatggatggcaaggcg
ggggcggaaaatctggtcaataaactgttgcaggacccgactctgctgaaaacgctggcg
aatgcgccgaaatcggccgctacccagcaagatgtgtcagcggataatgaatcagcggaa
taa

DBGET integrated database retrieval system