KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_0857Help
Entry
STM14_0857        CDS       T01714                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo00020  Citrate cycle (TCA cycle)
seo00640  Propanoate metabolism
seo00660  C5-Branched dibasic acid metabolism
seo01100  Metabolic pathways
seo01110  Biosynthesis of secondary metabolites
seo01120  Microbial metabolism in diverse environments
seo01130  Biosynthesis of antibiotics
seo01200  Carbon metabolism
Module
seo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:seo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STM14_0857 (sucC)
   00640 Propanoate metabolism
    STM14_0857 (sucC)
   00660 C5-Branched dibasic acid metabolism
    STM14_0857 (sucC)
Enzymes [BR:seo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     STM14_0857 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACY87361
UniProt: A0A0F6AYN8
Position
806408..807574
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIGKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagccgaagaagccgcgtctaaaatcggcgct
ggcccgtgggtagtgaaatgtcaggttcacgctggcggccgcggcaaagcgggcggtgtg
aaggtagtaaaaagcaaagaagagattcgcgccttcgcggaaaactggctgggcaaacgt
ctggtgacctatcaaacagacgctaatggccaaccggtaaaccagattctggttgaagcg
gcgaccgacatcggcaaagaactgtacctcggcgcggtagttgaccgtagttctcgtcgc
gtggtctttatggcgtctaccgaaggtggcgtagagatcgaaaaagtcgcggaggaaacc
ccgcatctgatccataaagtcgcgctcgatccgctgaccggcccgatgccgtatcaggga
cgggaactggcgttcaaattgggtctggaaggtaaactggtgcagcagttcaccaaaatc
tttatgggtctggcaaccattttccttgagcgcgacctggcgctgatcgaaatcaacccg
ctggtgattactaagcagggcgatctgatttgcctcgacggcaagctgggcgctgacggc
aacgcgctgttccgccagccggatctgcgtgaaatgcgtgaccagtctcaggaagacccg
cgtgaagcgcaggcagcgcagtgggaactgaactacgtcgcgctggacggcaacatcggt
tgcatggtgaacggcgcgggtctggcgatgggcaccatggacatcgttaagctgcatggc
ggcgaaccggctaacttccttgacgtgggcggcggcgcaaccaaagagcgcgtcaccgaa
gcgtttaaaattatcctctcggatgacaacgtgaaagcggttctggttaacatcttcggc
ggtatcgtccgttgtgacctgattgccgacggtatcatcggcgcggtggaagaagtgggc
gtgaacgttccggtggtggtgcgtctggaaggcaacaacgccgaactcggcgcgaagaaa
ctggctgacagtggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system