KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_2703Help
Entry
STM14_2703        CDS       T01714                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo00790  Folate biosynthesis
seo01100  Metabolic pathways
Module
seo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:seo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STM14_2703 (folE)
Enzymes [BR:seo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     STM14_2703 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACY89146
UniProt: A0A0F6B3Q6
Position
complement(2341997..2342665)
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHDALVARGLETPLRPPMDELDNETRKSLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgacgcgctggttgcccgggggctg
gaaacgccgctgcgcccgcctatggatgaactggataatgaaacgcgaaaaagccttatc
gcagggcatatgactgagattatgcagttgctgaatctcgatttgagcgatgacagtctg
atggaaacgccgcatcgtatcgctaagatgtacgttgacgagattttcgccggcctcgac
tatgccaatttcccgaaaattaccctcattgaaaataaaatgaaggtggatgaaatggtc
accgtccgcgatatcacgctgaccagcacctgtgaacatcacttcgtgaccattgatggc
aaagcgaccgtcgcgtatatccccaaagattccgtgatcggcctgtcgaaaattaaccgc
atcgtgcaattcttcgcccagcgtccgcaggttcaggaacgtttgacccaacaaattctg
acggcgctgcaaaccttgctcggcaccaataatgtagcggtatcgattgatgcggtgcat
tactgcgtgaaagcgcgcggtattcgtgacgcaaccagcgccacgacgacgacgtcgctg
ggcggattgtttaagtccagccagaatacgcgccaggagtttctgcgtgccgttcgccat
catccatga

DBGET integrated database retrieval system