KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_3263Help
Entry
STM14_3263        CDS       T01714                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Brite
KEGG Orthology (KO) [BR:seo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:seo03009]
    STM14_3263 (rluD)
Enzymes [BR:seo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     STM14_3263 (rluD)
Ribosome biogenesis [BR:seo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    STM14_3263 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 TruB_N
Motif
Other DBs
NCBI-ProteinID: ACY89688
UniProt: A0A0F6B594
Position
complement(2859464..2860444)
Genome map
AA seq 326 aa AA seqDB search
MAQRVQLTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILNQRVLVNGQLCDKPKEKVL
GGERVAIDAEIDEEIRFEAQDIPLDIVYEDDDILVINKPRDLVVHPGAGNPDGTVLNALL
HYYPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESLQLREITREYEAVAIGHMT
AGGTVNEPISRHPTKRTHMSVHPMGKPAVTHYRIMEHFRVHTRLRLRLETGRTHQIRVHM
AHITHPLVGDQVYGGRPRPPKGASEEFISTLRKFDRQALHATMLRLYHPVSGIEMEWHAP
IPQDMVDLIDAMRADFEDHKDDVDWL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgagtacaactcaccgcaacggtctccgaaaaccaactcggtcaacgctta
gatcaggctttggccgaaatgttcccggattattcacgttcgcgtataaaagaatggatt
ttgaatcagcgcgtgttggtcaatggtcaactttgcgataagccaaaagaaaaagtgtta
ggtggcgagcgggtggctattgatgcggagatcgacgaagagattcgttttgaagcgcag
gatatcccgttagatattgtttatgaagatgacgatattctggttatcaacaaaccacgc
gatctggtggtacatcctggcgcgggtaacccggacggtacggtactgaacgcgttgcta
cattattatccgccgattgcggatgtcccgcgcgcgggcattgtacatcgtctggataag
gacacgacggggctgatggtggtggccaaaaccgttccggcgcaaacgcgcctggtggag
tctttgcagctgcgcgagatcacccgcgaatatgaagcggtcgcgatcggacatatgacg
gcgggaggaacggtgaatgaacccatcagtcgtcacccgaccaaacgtacccatatgtca
gtgcatcccatgggcaaaccggcggtgacccactaccgcattatggaacatttccgtgtg
cacacgcgtcttaggctgcgtctggagaccgggcgtacgcaccagatccgcgtgcatatg
gcgcatattacgcacccgttagtgggcgatcaggtctacggtggtcgtccacgtccaccg
aaaggcgcatcggaagagtttatttccactctgcgtaagtttgaccgccaggcgcttcat
gcaacgatgctgcgtctctaccatcctgtatcgggtatcgaaatggagtggcacgcgccg
attccacaagatatggtggaccttatcgatgcgatgcgcgccgattttgaagatcataaa
gatgatgtggactggttatga

DBGET integrated database retrieval system