KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_3739Help
Entry
STM14_3739        CDS       T01714                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo00270  Cysteine and methionine metabolism
seo00480  Glutathione metabolism
seo01100  Metabolic pathways
Module
seo_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:seo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    STM14_3739 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    STM14_3739 (gshB)
Enzymes [BR:seo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     STM14_3739 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACY90145
UniProt: A0A0F6B6J8
Position
3276061..3277008
Genome map
AA seq 315 aa AA seqDB search
MIKLGIVMDPIAHINIKKDTSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE
QNYDKWYEFGSEQEIKLADLDVILMRKDPPFDTEFIYATYILERAEEEGTLIVNKPQSLR
DCNEKLYTAWFADLTPETLVTRNKAQLKAFWEKHGDIIMKPLDGMGGASIFRVKEGDPNI
GVIAETLTELGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG
RGEPRPLSESDWEIARRVGPTLKAKGLIFVGLDIIGDRLTEINVTSPTCVREIEAEYPIS
ITGMLMDAIEARLAK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctcggcatcgtgatggaccccatcgcacacatcaacatcaagaaagacacc
agtttcgctatgctgctggaagcccaacgtcgtggttatgaacttcattatatggagatg
gccgacctttatctgattaacggcgaagcccgcgcccgcacgcgaacgttgagcgtggag
caaaattacgataaatggtacgagttcggcagcgagcaggagattaaactcgccgatctg
gacgtcattttgatgcgcaaagatccgccgtttgataccgagtttatttatgcgacctat
attctggaacgcgctgaagaagaagggacgctgatcgtcaacaaaccgcaaagcctgcgc
gactgtaatgaaaaactgtatactgcctggtttgccgacctgaccccggaaacgctggta
acgcgcaataaagcgcagctcaaagcattttgggaaaagcacggcgatatcattatgaaa
ccgctggacggtatgggcggcgcgtccattttccgcgttaaggaaggcgatcctaacata
ggcgttattgccgaaacgctgaccgagctgggcaaccgctactgcatggcgcagaactat
ctgcccgctatcaaagatggcgataagcgcgtcctggtcgtcgacggcgagccagtgcct
tactgcctggcgcgtattccgcagggcggcgaaacccgcggcaacctggcggctggtggt
cgcggcgaaccccgtccgttgagcgaaagcgactgggaaatcgcccgccgcgttgggccg
acgcttaaagccaaagggcttattttcgtcggtctggatattatcggcgaccgcttaacg
gaaattaacgtgaccagcccaacctgcgtgcgtgaaattgaagcggaatacccgatctct
atcaccgggatgttgatggacgccatcgaagcgcgtctggcgaagtaa

DBGET integrated database retrieval system