KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_4444Help
Entry
STM14_4444        CDS       T01714                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo00051  Fructose and mannose metabolism
seo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    STM14_4444 (mtlD)
Enzymes [BR:seo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     STM14_4444 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: ACY90828
UniProt: A0A0F6B8I0
Position
3891080..3892243
Genome map
AA seq 387 aa AA seqDB search
MKVNTMKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENE
QVDTVSGVNAVSSIGDDVVDLIAHVDLITTAVGPVVLERIAPAIAKGLVKRKAQGVDAPL
NIIACENMVRGTTQLKGHVMNALADGDKAWVEQHVGFVDSAVDRIVPPSASATNDPLEVT
VETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTI
RDAILDESIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGR
QPLRKLSAGDRLIKPLLGTLEYGLPHVNLVKGIAAAMHFRSDEDPQAQELAALITEKGPQ
AALAQISGLDANSDVVAEAVNAYNATK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaatactatgaaagcattacattttggcgcaggtaatatcggtcgtggcttt
atcggcaaattgctggctgacgcggggatacaactgacgtttgcggatgtaaaccaggtc
gtactcgatgccctgaatgcccgtcatagctatcaggttcatgttgtgggtgaaaatgag
caggtggataccgtttccggcgtcaacgctgtcagcagcatcggcgatgatgttgtcgac
ctgattgcccacgttgatttaatcaccactgccgtgggcccggtggtgcttgagcgtatc
gctccggctatcgctaaagggctggtaaaacgtaaggcgcagggcgtggatgccccgctg
aatatcatcgcctgtgaaaatatggtgcgcggcaccacgcagctgaaaggccacgtaatg
aacgcgctggcggatggcgataaagcctgggttgaacagcacgtcggttttgtcgattcc
gccgttgaccgtattgtgccgccatctgcttctgcgaccaacgatccgctggaagtgacg
gtagaaacgttcagcgagtggattgtcgataaaacccagtttaaaggcgcgttgccaaac
attccggggatggagttaacggataacctgatggcatttgtcgaacgtaaactcttcacg
ctgaacacaggtcatgctataaccgcgtacctcggcaaattagccggtcatcaaaccatt
cgcgacgctattctcgatgagagtattcgcgcggtggtgaaaggcgcgatggaagaaagc
ggcgcggtgctgatcaaacgctacggttttgatgccgacaaacatgcggcatacattcag
aaaatcctcggtcgttttgaaaacccgtatctgaaagatgacgtcgaacgcgtaggtcgt
cagccgctacgcaaactcagcgcgggcgaccgtctgatcaaaccgctgcttggcaccctg
gaatatggtctgccgcatgtaaatctggtcaaagggatcgcggcggcgatgcatttccgt
agtgatgaagatccgcaggcgcaggagttggcggctctgattaccgaaaaaggcccgcag
gccgcgctggcgcaaatttccgggctggatgccaatagcgatgtggtggcggaggcggtt
aacgcatataacgcgaccaaatga

DBGET integrated database retrieval system