KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_4789Help
Entry
STM14_4789        CDS       T01714                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo00071  Fatty acid degradation
seo00280  Valine, leucine and isoleucine degradation
seo00281  Geraniol degradation
seo00310  Lysine degradation
seo00362  Benzoate degradation
seo00380  Tryptophan metabolism
seo00410  beta-Alanine metabolism
seo00640  Propanoate metabolism
seo00650  Butanoate metabolism
seo00903  Limonene and pinene degradation
seo00930  Caprolactam degradation
seo01040  Biosynthesis of unsaturated fatty acids
seo01100  Metabolic pathways
seo01110  Biosynthesis of secondary metabolites
seo01120  Microbial metabolism in diverse environments
seo01130  Biosynthesis of antibiotics
seo01200  Carbon metabolism
seo01212  Fatty acid metabolism
Module
seo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:seo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STM14_4789 (fadB)
   00650 Butanoate metabolism
    STM14_4789 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    STM14_4789 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    STM14_4789 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STM14_4789 (fadB)
   00310 Lysine degradation
    STM14_4789 (fadB)
   00380 Tryptophan metabolism
    STM14_4789 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STM14_4789 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STM14_4789 (fadB)
   00281 Geraniol degradation
    STM14_4789 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STM14_4789 (fadB)
   00930 Caprolactam degradation
    STM14_4789 (fadB)
Enzymes [BR:seo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     STM14_4789 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STM14_4789 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     STM14_4789 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     STM14_4789 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACY91152
UniProt: A0A0F6B9F0
Position
complement(4203001..4205316)
Genome map
AA seq 771 aa AA seqDB search
MISAERDHIGISLIIYLHFFNTKYTLRFIWYDQITLWIQETDMLYKGDTLYLDWLEDGIA
ELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAI
AVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPMTAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDIETPKQAAV
LGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLLNKQLERGKIDGLKLAGVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPETVLASNTSTIPIGELAS
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKDYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKPKKEEDAAVDDLLASVSQP
KRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVYGLGFPPFHGGAFRWLDTQ
GSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPARPVGSLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatctctgccgagcgtgatcacatcggcatttctttaatcatttatttgcattttttt
aacacaaaatacacacttcgcttcatctggtacgaccagatcactttgtggattcaggag
actgacatgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgcc
gaactggtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagc
ctcggccaggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgc
tctaataaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctc
gtccccgaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctg
gaagatttacccgtaccgacccttgccgccgtaaacggctatgcgctgggcggcgggtgc
gaatgcgtgctggccaccgattaccgtctggcgacgccagacctccgtatcggtctgccg
gaaactaaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctg
ggcgcagacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcg
ctgaaaatcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgata
gcggtgttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaa
ctggaaccgttgaaactcagtaagattgaagcagcgatgagctttaccatcgctaaaggc
atggtcgcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccatt
gaagccgccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgtt
ccgctggcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatat
gtaaaaggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgta
ctgggcgcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccg
gtcatcatgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaag
ctgctgaacaaacagctggagcgcggcaagatcgacggtctgaagctggcgggcgtcatt
tcgaccatccacccgactctcgattatgccggtttcgatcgcgtagatgttgttgtcgaa
gcggtagtcgaaaatccgaaagtcaaaaaagcggtactggcggaaaccgagcagaaagtg
cgcccggaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagc
gccctggaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatg
ccgctggttgaaatcattcgcggcgagaagagttcagacgaaaccattgccaaagtcgtc
gcctgggccagcaaaatgggcaagacaccgattgtagtcaacgactgccccggcttcttt
gttaaccgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcg
gatttccgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcc
tatctgctcgacgtggtgggtattgataccgcccaccacgcgcaggcagtaatggcggca
ggcttcccacagcgtatgcagaaagattaccgcgacgcgatcgacgcattgtttgacgcc
agccgttttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggt
aagccgaagaaagaagaagatgccgcggtggatgacctgctggcaagcgtcagccagccg
aaacgcgacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaa
gtggttcgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacag
ggcagcgcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgag
gtgccggaagggctgcgtaataaagcgcgccataacgaaccgtattatcccccggttgaa
ccagcccgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system