KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_4836Help
Entry
STM14_4836        CDS       T01714                                 

Gene name
yihU
Definition
(GenBank) putative oxidoreductase
  KO
K08318  4-hydroxybutyrate dehydrogenase / sulfolactaldehyde 3-reductase [EC:1.1.1.61 1.1.1.373]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo00650  Butanoate metabolism
seo01100  Metabolic pathways
seo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:seo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    STM14_4836 (yihU)
Enzymes [BR:seo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.61  4-hydroxybutyrate dehydrogenase
     STM14_4836 (yihU)
    1.1.1.373  sulfolactaldehyde 3-reductase
     STM14_4836 (yihU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 3HCDH_N TrkA_N UDPG_MGDP_dh_N ApbA Shikimate_DH Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACY91193
UniProt: A0A0F6B9J1
Position
complement(4247348..4248244)
Genome map
AA seq 298 aa AA seqDB search
MAVIAFIGLGQMGSPMASNLLKQGHQLSVFDVNPDAVQRLVDKGAQPASSPAQATIGAEF
VITMLPNGDLVRSVLFGEQGVCETLSREALVIDMSTIHPLQTDNLIADMQSKGFSMMDVP
VGRTSDNAITGTLLLLAGGTAEQVERATPVLMAMGNELVNTGGPGMGIRVKLINNYMSIA
LNALSAEAAVLCEALGLSFDVALKVMSGTAAGKGHFTTTWPNKVMKGDLSPAFMIDLAHK
DLGIALDVANQLHVPMPLGAASREVYNLARAAGRGREDWSAILEQVRISAGLTANVKK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcagttatagcatttatcgggttgggacagatgggctcccctatggcgagcaatctg
ctaaagcagggccatcaactcagcgtcttcgatgttaatcccgacgccgtacagcgtctg
gtagacaaaggcgcgcaacctgcaagcagcccggctcaggcaaccatcggcgctgaattt
gttatcaccatgctcccgaacggcgatctggttcgttccgttttgtttggcgagcaaggc
gtttgtgaaactctttcccgtgaagcgctggtcattgatatgtccactattcatccgttg
caaaccgataatctgattgccgacatgcagagcaaagggttcagcatgatggatgtgccg
gtaggccggacatccgacaacgcgattaccggcacattgttgctgctggcaggcggtacg
gcggagcaagtagagcgtgctacccctgttctgatggcgatgggtaatgagctggtcaac
accggcggcccgggaatgggtattcgcgtaaaactgatcaacaactacatgagtattgcg
ctaaatgcgctctccgccgaagccgccgtgctgtgtgaagcgctggggctttccttcgac
gtggctttaaaagtgatgagcggcactgccgcaggcaaagggcatttcaccaccacctgg
ccgaataaagtgatgaaaggagatctgtctcccgccttcatgatcgatctggcgcacaaa
gatcttggcatcgcgttggatgtcgccaatcaactgcacgtaccgatgccgctcggcgcc
gcctcccgtgaagtttataacctggcgcgggccgcaggccgcggtcgggaagactggagc
gccatcctggaacaggtgcgcatcagcgccgggctgaccgccaacgtaaaaaagtaa

DBGET integrated database retrieval system