KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 14028S: STM14_5029Help
Entry
STM14_5029        CDS       T01714                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
seo  Salmonella enterica subsp. enterica serovar Typhimurium 14028S
Pathway
seo00620  Pyruvate metabolism
seo00630  Glyoxylate and dicarboxylate metabolism
seo01100  Metabolic pathways
seo01110  Biosynthesis of secondary metabolites
seo01120  Microbial metabolism in diverse environments
seo01200  Carbon metabolism
Module
seo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:seo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    STM14_5029 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    STM14_5029 (aceB)
Enzymes [BR:seo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     STM14_5029 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACY91370
UniProt: A0A0F6BA18
Position
4415578..4417179
Genome map
AA seq 533 aa AA seqDB search
MNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDN
GKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKTLFR
EMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgagctg
gaaaagcaagtcctgaccgctgaagcagtcgagtttttgacggagttagtcacccgtttt
acgccaaaacgcaataaactcctggctgcccgtatccagcaacagcaggatattgataac
ggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcagatt
cgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaacgt
aaaatggtgattaatgccctgaacgcaaatgtgaaagtgtttatggcggattttgaagac
tcgctggcgccggactggaataaagttattgatggtcaaatcaacctgcgtgatgcggtg
aacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgatccg
gccgtattgatttgtcgtgtacgtggtctacatctgccagaaaaacatgttacctggcgg
ggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactataaa
gcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctggcag
gaggcagcctggtggagcgaagtgttcagctacgccgaagaccgctttaacctgccgcgc
ggtacgatcaaagcgaccctgttgattgaaacgctgccggctgttttccagatggatgag
attcttcatgcgctgcgtgatcatatcgtcggtctcaactgtggtcgctgggattatatt
ttcagctatatcaaaacgttgaaaaatcacccggatcgcgttttgccggacaggcaggtg
gtaacgatggacaaaccgtttctgagcgcctactcgcgcctgctgatcaaaacctgccac
aagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgttgaa
cgcaacaatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaacggc
cacgacggcacgtggattgcgcatcctgggttggcggataccgcaatggccgtctttaac
gaggtactgggcgagcacaaaaatcagctgttcattacccgtgatgaagatgcgccgatt
accgctgaacagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgcgcc
aatattcgcgtggcagtgcagtacattgaagcgtggatctccggcaatggctgtgtaccg
atttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctggcag
tggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaaacgcttttccgc
gaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctacagc
agcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgactta
atcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system