KEGG   Seonamhaeicola sp. S2-3: BWZ22_02755Help
Entry
BWZ22_02755       CDS       T04683                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
seon  Seonamhaeicola sp. S2-3
Pathway
seon00900  Terpenoid backbone biosynthesis
seon01110  Biosynthesis of secondary metabolites
seon01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:seon00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BWZ22_02755
Enzymes [BR:seon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     BWZ22_02755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: APY10219
UniProt: A0A1U7DNX0
Position
566660..567982
Genome map
AA seq 440 aa AA seqDB search
MSKSIAGFSKLSKSKKIDWIVETYFTNAESAKSILKQYWNSNEKLQQLHDEFIENTITNY
YLPLGVAPNFLINGKLYTIPMAIEESSVVAAASKAAKFWLERGGFKTTVISTTKIGQVHF
IYKGDFKKLTQYFNSIKPKLIDDTKPITSNMDKRGGGIIDIELRDKTEDINGYYQLHASF
ETLDAMGANFINSCLEQFAKTFKNEAQNFNLFSDEEKQIDIVMSILSNYVPDCLVRAEVS
CHVDDLTENNAVSGKDFAQKFIQAVNIAEIEPYRAVTHNKGIMNGIDAVVLATGNDFRAI
EACVHAYASRKGKYSSLTHAKIEGDTFKFWIEVPLALGTVGGLTSLHPLVKLALELLHKP
SAKELMQIIAVAGLAQNFAALRSLTTTGIQQGHMKMHLMNILNQFEATDVEKQTLTEHFK
NNTVTHSAVVEAIQNLRSKN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatctattgctggtttttctaaactttcaaagtctaaaaaaattgattggatt
gtagaaacttatttcaccaacgccgaaagtgccaaaagtattttaaaacaatattggaat
agcaacgaaaaactacaacaactgcatgatgagtttatagaaaacactataactaactat
tatttacctcttggtgtagctcctaactttttaataaatggtaaactttacaccattcca
atggcaattgaagaaagttcggttgttgctgctgctagtaaagctgctaaattttggtta
gagcgcggaggctttaaaaccacagtaatttctaccacaaaaattggtcaggttcatttt
atttataaaggtgattttaaaaaattaactcagtatttcaactctattaaacctaaactt
attgatgacacaaaacctattacatctaatatggataaacgtgggggtggtattatagat
attgaattacgagataaaactgaagacataaacggctactatcaactacatgcatctttt
gaaacattagatgctatgggtgccaattttataaactcctgcttagagcaatttgctaaa
acttttaaaaatgaagctcaaaacttcaatttattttctgatgaagaaaagcaaattgat
atagttatgagcattttatctaactatgttccagattgtttggttagagccgaagttagt
tgccatgtagacgatttaaccgaaaataatgctgtttctggtaaagactttgcccaaaaa
tttattcaagcagtaaatatagctgaaatagaaccctatagagctgtaacacacaacaaa
ggcatcatgaacggtattgatgccgttgttttggctacgggtaacgactttagagccatt
gaggcttgcgtgcatgcctatgcctcaagaaaaggtaaatacagcagtttaacacatgct
aaaattgaaggtgatacgtttaaattttggattgaagttccactagctttaggtactgtt
ggtgggcttacaagtttacaccctttagttaaactagctttagagttgttacacaagcca
tcggctaaagaactcatgcaaattattgcagtagcaggtttagctcaaaattttgcagct
ttacgttctcttacaacaactggtattcagcaaggacatatgaaaatgcacttaatgaat
attttaaatcagtttgaagccacagatgttgaaaagcaaaccttaacagaacattttaaa
aacaatactgtaacacatagtgcggtagttgaggctatacagaatttaagatcaaaaaac
taa

DBGET integrated database retrieval system