KEGG   Seonamhaeicola sp. S2-3: BWZ22_02815Help
Entry
BWZ22_02815       CDS       T04683                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
seon  Seonamhaeicola sp. S2-3
Pathway
seon00860  Porphyrin and chlorophyll metabolism
seon01100  Metabolic pathways
seon01110  Biosynthesis of secondary metabolites
seon01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:seon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BWZ22_02815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:seon01007]
    BWZ22_02815
Enzymes [BR:seon01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BWZ22_02815
Amino acid related enzymes [BR:seon01007]
 Aminotransferase (transaminase)
  Class III
   BWZ22_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: APY10230
UniProt: A0A1U7DNX8
Position
complement(578817..580103)
Genome map
AA seq 428 aa AA seqDB search
MIYQRSSALFAEAEKVIPGGVNSPVRAFKGVGGTPIFVKEAKGAYLYDEDGNRLIDYINS
WGPMILGHAYKPVVDAVIDKAQKGTSFGMPTEIETKIAELAVSMVPNIDKIRFVNSGTEA
CMSAVRLARGFTGKDKVIKFAGCYHGHSDSFLIQAGSGASTFGTPNSPGVTQGTAKDTLL
AKYNDIDNVKALIEANKGEVACVIIEPVAGNMGCIPPKDGFLQELRQVCDANNILLIFDE
VMTGFRLSKGGAQERFNIKADIVCFGKVIGGGLPVGAFASRNEIMNHLAPLGPVYQAGTL
SGNPLAMAAGLAMLKALNNDADIFNRLEEKTKYLHEGISKVLKENNVVNTVNRVGSMISV
HFYEHAVVDFDSAAKGNNNTFKKFFHGLLNEGVYIAPSAFETWFITDALTYKDLDFTINA
VNKVAKDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaaagaagcagtgctttgtttgccgaagcagaaaaagttattccaggaggt
gtaaattcgccagtaagagcctttaaaggagtaggaggaactcccatttttgttaaagaa
gccaaaggtgcttatttatatgatgaagacggaaaccgattgatagattatatcaattca
tggggacccatgattttagggcatgcctacaaaccagtggttgatgccgtaattgataag
gctcaaaaaggaacatcttttggaatgccaacagaaattgaaactaaaatagccgaatta
gcggtttcaatggtacctaatattgataaaataagatttgtaaattctggaaccgaagcc
tgtatgagtgctgtaaggttagcgagaggctttacaggtaaagacaaagtcatcaaattt
gcaggttgctatcacggtcatagcgattcttttttaatacaagcgggtagtggtgctagt
acttttggcacaccaaacagcccaggagtaacacaaggtaccgctaaagataccttgtta
gcaaagtataatgatattgataatgttaaagcacttatagaggctaataaaggagaagtt
gcttgtgtaattatagaacctgtagctggaaatatggggtgtattcctccaaaagatgga
tttttgcaagagctaaggcaggtttgtgatgctaataatatattactaatttttgatgaa
gtaatgacggggtttaggttgtcaaaaggtggtgcgcaagaacgctttaatattaaagca
gatattgtttgctttggaaaagtaattggaggtggtttgcctgttggggcatttgcatca
agaaacgaaattatgaatcatttagcaccattgggccctgtgtaccaagcaggaacttta
agtggaaatccgcttgctatggctgctggtttagcaatgttaaaagcgttaaataatgat
gccgatatttttaatagattagaagaaaaaacgaaatatttacatgaaggaattagtaaa
gtattgaaagaaaataacgttgtgaatactgtaaatagagttggttctatgatttctgtt
catttttatgaacatgcggtagtagattttgattcggcagctaaaggaaacaacaatact
tttaaaaagttttttcacggattacttaatgaaggtgtttatattgctccaagtgctttt
gaaacttggtttataacagatgcgttaacttacaaagatttagattttacaataaatgct
gttaataaagtagctaaagatttataa

DBGET integrated database retrieval system