KEGG   Seonamhaeicola sp. S2-3: BWZ22_03100Help
Entry
BWZ22_03100       CDS       T04683                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
seon  Seonamhaeicola sp. S2-3
Pathway
seon00511  Other glycan degradation
seon00600  Sphingolipid metabolism
seon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BWZ22_03100
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BWZ22_03100
Enzymes [BR:seon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BWZ22_03100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2 Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: APY12746
UniProt: A0A1U7DWE9
Position
643197..644615
Genome map
AA seq 472 aa AA seqDB search
MKLILILLTFLGVAQGCDDTDNTYYPPPEQSEVGAKYYLTTPDQSNLLALQTNNIFPLTD
NNNFTISVSESTTYQEMDGFGYTLTGGSAALINGMSTSAKESLLQELFGTGENSIGVNYL
RISIGSSDLDATTFSYNDLPAGQTDEDLTNFSLQPDMANLIPLLKDITAINPNIKILGSP
WSAPTWMKTNGSTIGGELLPQYYDTYANYFVKYIQGMAAEDITIDAITIQNEPENPYNNP
SMVMTAEQQKTFIRDYLGPTFQAENIATKIILFDHNLDHPEYPISILNDAATKSYIDGSA
FHLYEGKIDNMSLVHNAHPDKNVYFTEQWIQAPGDFYSDIRWHIRELIVGAPRNWSKTVL
EWNLAADPNNNPHTDGGCTECLGAITIDGNTVERNPAYYIIAHASKFVPAGSVRIESNYS
TEFPNVAYKTPEDNIVVIVLNNSDTQKTFNLNTPQEPITAILPAGSVGTFVW
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaattttaattcttctaacttttttaggagtagcacaaggatgcgatgataca
gacaacacgtattaccctcctccagagcaatcagaagtgggagcaaaatactatttaacc
acaccagatcagtccaatttattagcattacagacaaacaatatatttccattaaccgat
aataacaattttacaataagtgtttctgaaagtaccacctatcaagaaatggatgggttt
gggtatacattaacaggaggaagtgctgcgttaattaatggtatgtctacttctgcaaaa
gaaagcttattacaagagctttttggcacaggtgaaaacagtatcggagtcaactattta
agaattagtattggatcctcagacttagatgccacaacctttagttacaacgatttacct
gctggacaaaccgatgaagatttaactaacttttcattgcaaccagatatggctaatctt
attcccttgttaaaagatattacagccataaatccaaatataaaaattttaggttcacct
tggtctgctccaacttggatgaaaacaaacggctcaactataggaggcgaactcttacct
caatattatgacacctacgcgaactactttgtaaagtacatccaaggcatggctgcagaa
gatattactattgatgccatcaccattcaaaacgaacctgagaatccatataacaaccca
agtatggtgatgactgcagaacagcaaaaaacctttattcgcgattatttaggaccaaca
tttcaagcagaaaacattgccactaaaatcattctgtttgatcataacttagatcaccct
gaatatccgatttcaattttaaatgatgcggctactaaaagttatatcgacggttctgcg
tttcacttatacgaaggtaaaatcgataatatgtctttagttcacaatgcgcatcctgat
aaaaatgtttatttcacagaacaatggattcaagcgcctggagatttttattcagatata
agatggcatattagagaattaattgttggagcaccaagaaactggagtaaaactgtttta
gaatggaatttagctgcagatccaaataataatccacatacagacggtggatgcaccgaa
tgcttaggcgccattaccattgacggaaatactgtagaaagaaatcctgcttattacatt
attgctcatgcctcaaaatttgttccggctggttctgttagaatagaatctaattattct
acagaattcccaaatgttgcttataaaacgcctgaagacaacattgtggtcattgtatta
aataactctgatacacaaaaaacatttaacctaaacacacctcaagaacccattacagcg
atactaccagctggatctgttggaaccttcgtatggtaa

DBGET integrated database retrieval system