KEGG   Seonamhaeicola sp. S2-3: BWZ22_10580Help
Entry
BWZ22_10580       CDS       T04683                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
seon  Seonamhaeicola sp. S2-3
Pathway
seon00620  Pyruvate metabolism
seon00630  Glyoxylate and dicarboxylate metabolism
seon01100  Metabolic pathways
seon01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:seon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWZ22_10580
   00630 Glyoxylate and dicarboxylate metabolism
    BWZ22_10580
Enzymes [BR:seon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     BWZ22_10580
    1.2.1.22  lactaldehyde dehydrogenase
     BWZ22_10580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487 OmdA
Motif
Other DBs
NCBI-ProteinID: APY11658
UniProt: A0A1U7DTA1
Position
2433695..2435134
Genome map
AA seq 479 aa AA seqDB search
MKHYKQYINGQFIESKATSVIEILNPCTEEVISTISSGTVEDANNALEAAQAAQPAWEAL
PAIQRAAFLHKMADVIRENRVFLAETLSREQAKVIGLAQVEIDVTADYFDYNAGWARRIE
GEIIQSDREKEHIYLHKVPIGVAVGICPWNFPFFVMARKVAASLITGNTCVIKPSSEAPN
TIMEFAELIQKIDLPAGVLNFVCGSGRTVGNALSKNPITGIISLTGSVSAGQQVISAAAE
NITKVSLELGGKAPAIVCADANLELALNSIVASKVIFSGQVCNCAERVYVEDSIYDEFVD
KLTKKMSEVTIEDALTGVNADMSSLVSKSQLDKITEMVEFAKKEGAEVLVGGGRPDKFDK
GYFYQPTVLTNCKQDSQIIQEEVFGPVLPVMKFNTLDEAIALSNDTEFGLTSSIFSENFN
NIMKATNGLHFGETYVNREHFEAIQGFHAGWKKSGVGGADGKYGMEEYLHTKVVYAKYY
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattacaagcaatatattaatggtcaatttatagaatcaaaagcgacgtctgta
attgaaatattaaatccatgtacagaagaagttataagtaccatatctagtggtactgta
gaagatgcaaataatgctttagaagctgctcaagcagcgcaaccagcttgggaagcttta
ccagcaatacaaagagctgcatttttacataaaatggcagatgttattagagaaaaccgt
gtttttctagccgaaactttgtcaagagaacaggcaaaagttattggtttggctcaagtt
gaaattgatgttactgcagattattttgattataatgcaggttgggcgagaagaatagaa
ggtgaaataatacaaagtgatagagaaaaagaacatatttatttacataaagtaccaata
ggtgtagctgttgggatttgcccgtggaattttccattttttgtaatggctcgtaaagta
gccgcctctttaattacaggaaatacttgtgtaattaaacctagttctgaagctccaaac
actataatggaatttgcagaattaattcaaaaaattgatttacctgctggtgttttaaac
tttgtttgtggatctggtagaactgttggtaatgcactgtcaaaaaatcctattactggt
attattagcttaacaggaagtgtgtctgcaggacaacaagttatcagtgctgctgcagag
aatattacaaaagtttctttagagctaggaggaaaagctccagccattgtctgtgcagat
gctaatttagagttagctttaaattctattgtagcctctaaggttatttttagcgggcag
gtttgtaactgtgcagaaagagtatatgttgaagatagtatttatgacgagtttgttgat
aaattaacaaaaaaaatgagcgaggttactattgaagatgcattaacaggtgtaaatgca
gacatgagtagcctagtatctaaatcacaattagataaaataaccgaaatggttgagttt
gctaaaaaagaaggtgccgaagttttggttggaggcgggcgtcccgataagtttgataag
gggtatttttatcaaccaacagtattaactaattgtaaacaagatagtcaaataattcaa
gaagaagtatttggaccagtattgccagtaatgaagtttaatacgcttgatgaggctatt
gctttatctaatgatactgaatttggcttaacttcttccattttctcagaaaattttaac
aatataatgaaagcaaccaacggtttacattttggtgaaacttatgtaaacagagaacat
tttgaagctattcaagggtttcatgctggttggaaaaaatctggagtaggtggtgccgat
gggaaatatggtatggaagaatatctacatactaaagtagtatatgcaaaatactattaa

DBGET integrated database retrieval system