KEGG   Seonamhaeicola sp. S2-3: BWZ22_16440Help
Entry
BWZ22_16440       CDS       T04683                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
seon  Seonamhaeicola sp. S2-3
Brite
KEGG Orthology (KO) [BR:seon00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BWZ22_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: APY12712
UniProt: A0A1U7DWG4
Position
3746973..3747359
Genome map
AA seq 128 aa AA seqDB search
MVQQVTKGIKISVETTYEGSFYRNYKIQYAFGYKVTIENQSKDSVQLQSRHWEILDALNN
EEIVDGEGVIGKKPVLEPGESHTYTSGCLLTSPFGAMQGYFTMVNFTTTKKFNVDIPTFK
LSAPFAIN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtacaacaagtaacaaaaggcataaagatttcagtagaaactacctacgaaggctca
ttttatagaaattataaaatacagtatgcttttggttataaagtaaccattgaaaaccaa
agtaaagactctgtacaattacaatcacgccattgggagattctagacgcactaaataac
gaagaaattgttgatggcgaaggtgttataggcaaaaaacccgttttagaaccaggagaa
tctcacacttatacatctggctgtttgttaacttctccgtttggtgccatgcaaggatat
ttcaccatggttaactttaccactactaaaaagtttaatgtagacatccctacttttaaa
ctaagcgcaccatttgctattaattag

DBGET integrated database retrieval system