KEGG   Staphylococcus epidermidis ATCC 12228: SE0050Help
Entry
SE0050            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1643
Motif
Other DBs
NCBI-GeneID: 1056891
NCBI-ProteinID: NP_763605
UniProt: A0A0H2VDZ1
Position
complement(55264..55467)
Genome map
AA seq 67 aa AA seqDB search
MKAISESDTVILAYGAYAKRPVVVERVEQVMEMLKPHKKKVKKLINPVTNEVMHPLNPKA
RQKWTLK
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattagtgaaagtgacacagtgattctagcctatggagcttatgcgaagcgg
cctgttgtcgtcgaacgtgttgagcaagtgatggaaatgttaaaacctcataaaaagaaa
gtcaaaaaactcattaatccagtaacgaacgaagttatgcatccacttaaccctaaagca
cgtcaaaaatggacattaaaataa

DBGET integrated database retrieval system