KEGG   Staphylococcus epidermidis ATCC 12228: SE0067Help
Entry
SE0067            CDS       T00110                                 

Definition
(RefSeq) transposase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF772
Motif
Other DBs
NCBI-GeneID: 1056919
NCBI-ProteinID: NP_763622
UniProt: A0A0H2VGQ0
Position
complement(67822..67992)
Genome map
AA seq 56 aa AA seqDB search
MMLKVVLYTYTQSVFSGRKIEKLLNDRIRMVWLSQNLKHSYKTINRFRVNPKVMLY
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaaaagtagttctatatacctacacacaatctgtgttttcaggacgtaagata
gaaaaattgctcaatgatagaatccgaatggtgtggctgtcacaaaatctaaagcattct
tataaaacgattaatcgatttagagtaaatcccaaagtgatgctttattag

DBGET integrated database retrieval system