KEGG   Staphylococcus epidermidis ATCC 12228: SE0253Help
Entry
SE0253            CDS       T00110                                 

Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00020  Citrate cycle (TCA cycle)
sep00260  Glycine, serine and threonine metabolism
sep00280  Valine, leucine and isoleucine degradation
sep00620  Pyruvate metabolism
sep00630  Glyoxylate and dicarboxylate metabolism
sep00640  Propanoate metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
Module
sep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sep_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0253
   00020 Citrate cycle (TCA cycle)
    SE0253
   00620 Pyruvate metabolism
    SE0253
   00630 Glyoxylate and dicarboxylate metabolism
    SE0253
   00640 Propanoate metabolism
    SE0253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE0253
   00280 Valine, leucine and isoleucine degradation
    SE0253
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SE0253
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SE0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox GIDA HI0933_like K_oxygenase NAD_binding_8 FAD_binding_2 FAD_oxidored AlaDh_PNT_C 3HCDH_N Lycopene_cycl XdhC_C TrkA_N NAD_binding_7 Thi4 RcsD_ABL DAO FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 1056281
NCBI-ProteinID: NP_763808
UniProt: A0A0H2VEG1
Position
252123..253532
Genome map
AA seq 469 aa AA seqDB search
MQMKLGWHNVLLVKGGIYYMSKSYDLIVIGAGPGGYVAAIRGAQLGKNVAVIEKNNAGGT
CLNVGCIPSKTLLEHGEKAHSIRVANDWGITTKDLKIDFTQFVQRKKKVVQTLTGGVKQL
LKKNKVTYIEGEARISKNLKVDVNNETYQAKDIILATGSQPFIPPIDGLDQVNYETTDTF
FDLEKLPKQLAVIGGGVIATELASSMADLGVRVTIIEVADDILLTEINETREMLKAHLDN
QGIKILTKAKIKQVKESKIILDGQDDVSFDTLLVATGRQPNTQVAKDLNLEMDGKFFKVN
EHYETSQKHVYAIGDLIKGYQLAHAASAHGIHVVETIMNKQPSLVRQEDITRCIYTRLEA
ASVGLSEAQAKEAGYDVKVTQSAFQGNAKALIKGENEGFIKLVVDKKYGEVLGAFIVGPH
ATDIIGELLSVKASEGTIHELSQIIQPHPALLEAIGESADAFFDSAIHM
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgaaattgggatggcacaacgtactattggtgaaaggaggcatttattatatg
agtaaatcatatgacttaatcgtaataggagctggacctggtggctatgtagctgcaata
cgtggtgcgcaacttggtaaaaatgttgcagtcattgaaaaaaataatgctggaggcacg
tgcttaaatgtaggttgcatcccctctaaaacgttgttagaacacggcgagaaagcacac
agcatacgagttgcaaacgattggggaatcacaacgaaagacttaaaaattgattttact
caatttgtccaacgaaaaaagaaagttgtacaaacacttacgggtggcgtgaagcagttg
ttaaagaaaaataaagttacttatattgaaggggaagcacgaatttctaaaaacttaaaa
gtggacgttaataatgaaacgtatcaagcgaaagatataattttagcaactggcagtcag
ccgttcattccaccaattgatgggttagatcaagtcaattatgaaacaaccgatacattt
ttcgatttagagaagctaccaaaacagttagcggttatcggtgggggtgtgattgcaaca
gaactcgcatcctcaatggctgatcttggagttagagttacgataatagaagttgcagat
gacattttattaactgaaatcaacgaaactagagaaatgttaaaagcacatttagataat
caaggtattaagatactgacgaaagcaaagataaaacaagttaaggaatcgaaaataata
ttagatgggcaagatgatgttagctttgatacccttcttgttgcaacaggtagacaaccg
aatacgcaagttgcaaaagatttaaatttggaaatggatggtaaattctttaaagtcaat
gaacattatgaaacgagtcaaaaacatgtctatgctataggagatttaattaaaggatat
caacttgcacatgcagcaagtgcacatggcattcatgttgtcgaaacaataatgaacaaa
cagccgtcacttgtgcgtcaagaagatattacgcgttgtatatacacaagactggaagca
gcatcagttgggttatcagaagcgcaagctaaagaggctggttatgatgtgaaagtgact
caatcagcatttcaagggaatgcaaaggcgttaatcaaaggagaaaatgaaggatttatt
aaacttgtcgttgataaaaagtatggagaggttcttggtgcttttattgtaggaccacat
gctacagatataattggagaacttttaagtgtcaaagcatcagagggtacgattcatgaa
ctttctcaaattattcaaccacacccggctttattagaagcaataggtgagagtgcagat
gcattttttgattctgcaattcatatgtag

DBGET integrated database retrieval system