KEGG   Staphylococcus epidermidis ATCC 12228: SE0547Help
Entry
SE0547            CDS       T00110                                 

Definition
(RefSeq) thioredoxine reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SE0547
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     SE0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored FAD_binding_2 DAO GIDA Thi4 NAD_binding_8 HI0933_like Lycopene_cycl FAD_binding_3 K_oxygenase NAD_binding_7 NAD_binding_9 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-GeneID: 1057773
NCBI-ProteinID: NP_764102
UniProt: Q8CPY8
Position
543661..544593
Genome map
AA seq 310 aa AA seqDB search
MTEVDFDVAIIGAGPAGMTAAVYASRANLKTVMIERGMPGGQMANTEEVENFPGFEMITG
PDLSTKMFEHAKKFGAEYQYGDIKSVEDKGDYKVINLGNKEITAHAVIISTGAEYKKIGV
PGEQELGGRGVSYCAVCDGAFFKNKRLFVIGGGDSAVEEGTFLTKFADKVTIVHRRDELR
AQNILQERAFKNDKVDFIWSHTLKTINEKDGKVGSVTLESTKDGAEQTYDADGVFIYIGM
KPLTAPFKNLGITNDAGYIVTQDDMSTKVRGIFAAGDVRDKGLRQIVTATGDGSIAAQSA
ADYITELKDN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtagattttgatgtagcaataatcggtgcaggtcctgccggtatgacagca
gcagtatatgcatctcgtgccaatttaaaaactgtcatgattgaacgcggtatgccaggc
ggtcaaatggcaaacactgaagaagtagagaattttccaggatttgagatgatcacaggt
cctgacttatctactaaaatgtttgaacatgctaaaaaatttggtgcggaataccaatat
ggcgatattaaatctgttgaagataaaggcgactataaagttatcaatttagggaataaa
gagataacagcacatgcagttattatctcaactggagcagagtataaaaagattggcgtt
cctggtgaacaagaattaggaggacgtggagtaagttattgtgcggtttgtgatggagca
ttctttaaaaataaacgtcttttcgtaattggcggcggagattcagcggtagaagaaggt
actttcttaactaaatttgcagataaagtaacgattgttcaccgtagagatgaattacgt
gcacaaaacatcttgcaagaacgtgccttcaaaaatgataaagttgactttatttggagt
catacacttaaaacaattaatgaaaaagatggtaaagttggttcagttacacttgaatca
actaaagatggtgctgaacagacttatgatgccgacggtgtattcatttatattggaatg
aaaccactcacagcaccatttaaaaatcttggtattacaaatgacgcgggatacattgtc
acacaagatgacatgagtactaaagtacgaggtatttttgctgcaggtgacgttcgtgat
aaagggttacgtcaaattgttactgctacaggagacggtagtattgcggctcaaagtgca
gctgattatattacagaattaaaagataattaa

DBGET integrated database retrieval system