KEGG   Staphylococcus epidermidis ATCC 12228: SE0928Help
Entry
SE0928            CDS       T00110                                 

Definition
(RefSeq) xerC protein
  KO
K03733  integrase/recombinase XerC
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Chromosome and associated proteins [BR:sep03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SE0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_1 Phage_int_SAM_4 Phage_int_SAM_5 Peptidase_C30 Integrase_1
Motif
Other DBs
NCBI-GeneID: 1057574
NCBI-ProteinID: NP_764483
UniProt: Q7ZAJ4
Position
929825..930715
Genome map
AA seq 296 aa AA seqDB search
MDKIQETFLYMLKVERNFSEYTLKSYHDDLVQFNNFLEREHLQLETFEYKDARNYLAFLY
SNQLKRTTVSRKISTLRTFYEFWMTQDNSIINPFVQLVHPKKEKYLPQFFYEEEMEALFQ
TVEHDNKKGIRDKVIIELLYATGIRVSELINIKLKDIDMNLPGVKVLGKGNKERFIPFGE
FCRQSIERYLEEFQPKQLANHDYLIVNMKGDPITERGVRYVLNDVVKRTAGVNDIHPHKL
RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKKGE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaatccaagaaacatttttatatatgttaaaggttgaaagaaacttttcagag
tatacgttaaaatcttatcatgatgatttagttcaatttaacaactttttagaaagagaa
catttacaacttgagacttttgaatataaagatgctagaaactatttggcttttttatat
tctaatcaattaaaaagaactacggtgtcaagaaagatatcaactttacgtaccttctat
gaattttggatgactcaagataattcaattattaatccctttgttcaactagtgcatcct
aaaaaagagaagtatttacctcaattcttttatgaagaagaaatggaagcactttttcaa
actgtagagcatgataataaaaaaggcatacgagacaaagttattattgaattgttatat
gcaacaggaatacgtgtgtctgaattaataaatattaaactaaaagatatagatatgaac
ttaccaggtgtaaaagttttaggtaaaggaaataaggaaaggtttatcccttttggagag
ttctgtagacagagtatagaaagatacttagaagaattccaacctaaacaattagccaat
catgattatttaattgtaaatatgaaaggtgatcctatcaccgaaagaggagtaagatat
gtacttaatgatgtcgttaaaagaaccgctggcgtcaatgacatacatcctcataaatta
agacatacttttgctacacatttattaaatcaaggtgctgatttaaggactgtacaatct
ttacttggtcacgtcaatttatcgactactggacgttatacacatgtttcgaatcaacaa
ctgagaaaggtgtatttaaacgcacatcctcgagcaaaaaaaggagagtaa

DBGET integrated database retrieval system