KEGG   Staphylococcus epidermidis ATCC 12228: SE1005Help
Entry
SE1005            CDS       T00110                                 

Definition
(RefSeq) transposase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1_6
Motif
Other DBs
NCBI-GeneID: 1057599
NCBI-ProteinID: NP_764560
UniProt: A0A0H2VHK3
Position
1010531..1010674
Genome map
AA seq 47 aa AA seqDB search
MELVDGFTKVILSFIRMSIRNIIKVKIEIAFVLMLMNIKKVVAQQFK
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
gtggaacttgttgatggatttacgaaagttattttgagtttcatccgaatgtcgattcga
aacataattaaagtcaaaatagaaattgcatttgtattaatgctaatgaatataaaaaaa
gtagttgctcaacaatttaaataa

DBGET integrated database retrieval system