KEGG   Staphylococcus epidermidis ATCC 12228: SE1077Help
Entry
SE1077            CDS       T00110                                 

Definition
(RefSeq) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00300  Lysine biosynthesis
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SE1077
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     SE1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2
Motif
Other DBs
NCBI-GeneID: 1055957
NCBI-ProteinID: NP_764632
UniProt: Q8CSM7
Position
1090411..1091133
Genome map
AA seq 240 aa AA seqDB search
MVQHLSAQEIIQYISDAKKSTPLKVYVNGHFENVTFPESFKVFGSEHSKVIFCEANEWKQ
FYQQNHSLITELEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATIN
IGAIVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVVIEDNVLIGANAV
ILEGVRVGAGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQTSEVQDSKREIVSALRKLNNE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtacaacatttatcagctcaagaaatcattcaatatattagtgatgctaagaaatca
acaccactcaaagtttatgtaaatggtcattttgaaaatgtcacattcccagaatctttt
aaagtttttggctctgaacattcaaaagtaattttctgtgaagcaaatgaatggaaacaa
ttttatcaacaaaatcattcattaatcactgaattagaaattgagatggatcgtcgtaat
tcagctataccgcttaaagatttaacaaacacaaatgctcgtattgagccaggtgcgttt
attcgtgagcaagcaatcattgaagatggtgctgtggttatgatgggtgctacgattaat
attggagctattgtaggagaaggaacaatgatagacatgaacgcaacacttggtggacga
gctacaacaggaaaaaatgttcatgttggtgcaggtgctgttttagctggtgtcattgaa
cctccaagtgcttccccagttgtcattgaagacaatgttttaattggagcaaatgctgtt
attcttgaaggtgtacgcgttggtgcaggtgctattgtagcagctggagctattgtaact
caagatgtgccagctggagctgtagttgctggtacgcctgctaaagtaattaaacaaact
tcagaagttcaagactcaaaacgtgagattgtgtctgcactgcgtaaattaaataatgaa
taa

DBGET integrated database retrieval system