KEGG   Staphylococcus epidermidis ATCC 12228: SE1163Help
Entry
SE1163            CDS       T00110                                 

Gene name
engA
Definition
(RefSeq) GTP-binding protein EngA
  KO
K03977  GTPase
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Ribosome biogenesis [BR:sep03009]
 Prokaryotic Type
  GTPases
   SE1163 (engA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 KH_dom-like FeoB_N GTP_EFTU Dynamin_N AIG1 RsgA_GTPase Roc Ras cobW ABC_tran RNA_helicase Nuc_deoxyrib_tr Arf SRPRB AAA Nuc_deoxyri_tr2 SRP54
Motif
Other DBs
NCBI-GeneID: 1055792
NCBI-ProteinID: NP_764718
UniProt: Q8CP62
Position
complement(1199934..1201244)
Genome map
AA seq 436 aa AA seqDB search
MTKPIVAIVGKPNVGKSTIFNRVVGERISIVEDTPGVTRDRIYSSGEWLTHEFNIIDTGG
IEIGDAPFQTQIRAQAEIAIEEADVIIFMVNVREGLTQSDEMVAQMLYKSKKPVVLAVNK
VDNLEMRNDIYDFYSLGFGDPYPISGSHGLGLGDLLDAVVENFNKESEDPYDEDTIRLSI
IGRPNVGKSSLVNAILGEERVIVSNVAGTTRDAIDTEYSYDGQDYVLIDTAGMRKKGKVY
ESTEKYSVLRALKAIERSEVVLVVIDAEQGIIEQDKRVAGYAHEEGKAIVIVVNKWDTVE
KDSKTMKKFTDDVRNEFQFLDYAQIAFVSAKEGLRLKTLFPYINQASENHKKRVQSSTLN
EVVTDAISMNPTPTDKGRRLNVFYTTQVAIEPPTFVVFVNDVELMHFSYRRYLENQIRNA
FGFEGTPIHIIPRKRN
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaccgatagtagcaattgtaggaaaaccaaatgtaggaaaatctacaattttt
aatagagttgtcggcgaacgtatatctatcgtagaagatacgccaggcgttactcgtgat
cgtatttattcatctggcgagtggttaactcatgaatttaacatcattgatacaggtggt
attgaaattggagatgctccttttcaaactcaaatccgtgcacaggcagaaatagcaatt
gaagaagcagatgtcatcatttttatggtcaatgttagagaaggacttacacaaagtgac
gaaatggtcgcacaaatgctttataaatctaagaaacctgttgtattagctgtgaataaa
gttgataatcttgaaatgcgtaatgatatctatgatttctattctttaggctttggagat
ccatatcctatttctggttcacatggattaggacttggagatttgctagatgcagttgtt
gaaaactttaataaagaatcagaagatccttatgacgaagatacgatacgtctttctatc
atcggtagacctaatgttggtaaatctagcttggtcaatgctattttaggcgaagaacgt
gttattgtgtctaatgttgctggtacaactcgagatgccattgataccgagtactcttat
gatggacaagattatgtattgattgatactgctggaatgagaaaaaaaggtaaggtgtat
gaatcgactgaaaaatattctgtattacgtgcattaaaagcgattgagcgttcagaagta
gtattagtagttatcgatgctgaacaaggtataattgaacaagataaacgtgtagctggc
tatgcacatgaggaaggtaaagctattgtcattgtagtaaataaatgggatacagttgaa
aaagatagtaagacaatgaaaaaattcactgatgatgttagaaatgaatttcaattttta
gattatgctcaaatcgcgttcgtatcagcaaaagaagggctaagattaaaaacattattc
ccttatatcaatcaagccagtgaaaatcataaaaagcgtgtccaaagttctacactaaat
gaagttgttactgatgccatctctatgaatccaacacctactgacaaaggtagaagactt
aatgtattctatacaactcaggttgcaattgaaccaccgacatttgtagtatttgtcaat
gatgttgaattaatgcatttttcttataggagatatttagaaaatcaaatacgtaatgct
tttggttttgaaggaacacctattcatattattccaagaaaaagaaattaa

DBGET integrated database retrieval system