KEGG   Staphylococcus epidermidis ATCC 12228: SE1175Help
Entry
SE1175            CDS       T00110                                 

Definition
(RefSeq) respiratory response protein SrrB
  KO
K07651  two-component system, OmpR family, sensor histidine kinase ResE [EC:2.7.13.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02020  Two-component system
Module
sep_M00458  ResE-ResD (aerobic and anaerobic respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SE1175
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SE1175
Protein kinases [BR:sep01001]
 Histidine kinases
  OmpR family
   SE1175
Two-component system [BR:sep02022]
 OmpR family
  ResE-ResD [MD:M00458]
   SE1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_5 DUF1088 Halogen_Hydrol HATPase_c_2 PspB CstA Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 1055882
NCBI-ProteinID: NP_764730
UniProt: A0A0H2VHW1
Position
complement(1211908..1213674)
Genome map
AA seq 588 aa AA seqDB search
MNRLNSVVIKLWLTIILIVATVLILLSVSLITFIQYYFTQETENAIKEDAKRISSLVEKS
HNKTLAIQNSQTLIDGDGPGGLIIMKDMSEKPDSSYKDTKKQMFNEIKKSTKFKKVFKEG
EYETQNITIKNKGNSQSYLLLGYPMKAQKGAQSHYSGVFIYKDLKSIEDTNNAITIIILI
TAIIFTIASTIFAFFLSNRITKPLRQLKTQAQKVSEGDYSQISTVATKDEIGDLSRAFNN
MNVEIQEHIKAISSSKNIRDTLLNSMVEGVLGINNQREIILSNKMADDIMRHIDDFSKES
IEQQIEATFESQQNEYLELEINTRYYVFISSYIDRIQTNGRSGIVMVIRDMTNEHNLDQM
KKDFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIRDSLAIVLDESKRLNRLVNELLN
VARMDAEGLSVEKELQPIQHLLDKMESKYRMQSEELGLTMTFDSNNDEQLWNYDMDRMDQ
VLTNLIDNATRYTQAGDSIKISIDEDSDFNILTITDTGTGIAPEHLKQVFDRFYKVDAAR
KRGKQGTGLGLFICKMIIEEHGGRIDVESELGKGTSFIIRLPKSKQIS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgactaaatagtgttgttataaaactgtggttaactattattttaatagtagcg
acagttttaattttattaagtgtttcattaatcacttttatacaatattactttacgcaa
gaaacagaaaatgcaattaaagaagatgccaaaagaattagttcacttgttgagaagtct
cataacaaaacattagctatccaaaatagccaaacactcattgatggtgatggaccgggt
ggcctcattattatgaaagacatgagcgagaaaccagactcatcgtataaagacactaaa
aaacaaatgtttaatgaaataaaaaagagtactaaatttaaaaaagtgtttaaagaaggt
gagtatgaaactcaaaatattacaataaaaaataaaggtaattctcaatcttatcttttg
ctaggatacccaatgaaagctcaaaaaggtgctcaaagtcattatagtggtgtttttata
tataaagatttgaaatctatcgaagatacaaataatgctattacaattattatattaata
actgctattatatttactatagcaagcacaatatttgcattctttttatctaatagaata
acgaaacccttacgtcaattaaaaacacaagcacaaaaagtttctgaaggggattatagt
caaatttcaactgtcgctactaaagatgaaataggtgatttatcacgtgcatttaacaac
atgaacgtagaaattcaagaacatatcaaagcaatttcttcatctaagaatataagagat
acattattaaactctatggtagaaggcgttctaggcattaataatcaacgtgaaatcata
ttgtcgaacaagatggctgatgatattatgcgtcacattgatgatttttcaaaagaatct
attgaacagcaaattgaagcaacatttgaatcacaacagaatgagtatttagaattagaa
attaatacaaggtactatgtatttatctccagttatatagatagaattcaaacaaatggt
agaagtggtattgtcatggtcatccgtgatatgacaaatgaacataatcttgatcaaatg
aaaaaagattttatagcaaatgtatcacatgaattacgtacgccaatctctttattacag
ggttacactgagtccatagtagacggtatagttaccgaaccagatgaaatacgtgactca
ttagcaatcgttttagatgaatctaagcgacttaatcgtttagtcaatgaattactaaat
gtagctcgtatggatgctgaaggattatcagttgagaaggaattacaacctattcaacac
cttcttgataaaatggagtctaaatatcgcatgcaaagtgaagaattaggtttaacaatg
acgtttgattctaataatgacgaacaattatggaactatgatatggatagaatggaccaa
gtgttaactaatttaattgataacgcaacaagatatacacaagctggtgattctataaag
atttctattgatgaagattcagatttcaatattttaacaataactgatacaggcactggt
atagcgccggaacatctgaaacaagtatttgaccgtttttataaagtggacgctgctcga
aaaagaggtaagcaaggcaccggattaggacttttcatttgtaaaatgattattgaagaa
cacgggggacgtattgatgttgagagcgaattaggcaaaggtacttcatttattattaga
ctacctaaatcaaaacaaattagttag

DBGET integrated database retrieval system