KEGG   Staphylococcus epidermidis ATCC 12228: SE1207Help
Entry
SE1207            CDS       T00110                                 

Definition
(RefSeq) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00061  Fatty acid biosynthesis
sep00620  Pyruvate metabolism
sep00640  Propanoate metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
sep01212  Fatty acid metabolism
Module
sep_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SE1207
   00640 Propanoate metabolism
    SE1207
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SE1207
Enzymes [BR:sep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SE1207
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SE1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-GeneID: 1056026
NCBI-ProteinID: NP_764762
UniProt: A0A0H2VGC2
Position
complement(1243564..1244922)
Genome map
AA seq 452 aa AA seqDB search
MKKILIANRGEIAVRIIRAAHDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYL
NIPNILSIATSTGCDGVHPGYGFLAENGDFAELCEACQLKFIGPSYQSIQKMGIKDIAKA
EMIKANVPVVPGSEGLIQSIDDAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGY
RMTQQEAETAFGNGGLYLEKFIENFRHIEIQIIGDTYGNVIHLGERDCTIQRRMQKLVEE
APSPVLSEDKRQEMGNAAIRAAKAVNYENAGTIEFIYDLDDNQFYFMEMNTRIQVEHPVT
EMVTGVDLVKLQLKVAMGEALPFKQEDISINGHAIEFRINAENPYKNFMPSPGKITQYLA
PGGFGVRIESACYTNYTIPPYYDSMVAKLIVHEPTREESIMTGIRALSEYLVLGIDTTIP
FHLRLLNNHIFRSGEFNTKFLEKYNIMDDNNQ
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattttaatcgctaatcgtggtgaaatcgcagtaagaataataagagcggca
cacgatttaggtattcaaacagtagctatatactcagaaggtgacaaagatgcattacat
actcaaattgctgatgaagcatactgcgtcggtcctactttatcaaaagattcttattta
aatataccaaatattttatctatcgctacttctacaggatgtgatggtgttcatcctgga
tacggttttttggctgaaaatggtgattttgctgaattgtgtgaagcatgccaattaaaa
tttattgggccaagctatcaatcaattcagaaaatgggaataaaagatattgctaaagct
gaaatgattaaagccaatgtacctgtagtaccaggaagtgaaggacttattcaaagtata
gatgacgctaaaaaaatagctaaaaaaatcggctatccagttatcatcaaagccacagca
ggtggtggtggaaaaggtattcgggttgctcgtgatgagaaagaacttgaaactggttac
cgtatgacacaacaagaagctgaaaccgcgttcggaaatggtggtttatacttagaaaaa
tttatagaaaactttagacatatagagattcaaattattggcgatacttatggaaacgtt
atacatttaggtgaacgtgattgtacaattcaaagaagaatgcaaaagctcgttgaagaa
gcaccctcaccagtactaagtgaagataaacgccaagaaatgggtaatgctgcaattaga
gctgcaaaagctgtaaattatgaaaacgcaggtacaattgaatttatatatgatttagat
gataaccaattttatttcatggaaatgaatacacgtattcaagttgaacacccagtaact
gaaatggtaacaggagtagatttagtaaaattacaactcaaagttgctatgggtgaggcg
ttaccttttaaacaagaagatatttccattaacggtcacgctattgaatttcgaatcaat
gctgaaaatccttacaaaaactttatgccatcaccaggcaagattacccaatatcttgct
ccaggcggttttggagtgagaattgaatcagcatgttatactaattatacgataccacct
tactatgactccatggtggcaaaacttatagttcacgaacctacacgtgaagaatcaatt
atgacaggcattcgtgctttaagtgaatatcttgttttaggtatcgacactacgattcca
ttccacttaagacttctaaataatcatatttttagaagtggggaatttaatacaaaattc
ctagaaaagtataatattatggacgataataaccaatag

DBGET integrated database retrieval system