KEGG   Staphylococcus epidermidis ATCC 12228: SE1392Help
Entry
SE1392            CDS       T00110                                 

Definition
(RefSeq) iron-sulfur cofactor synthesis protein nifZ
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00730  Thiamine metabolism
sep01100  Metabolic pathways
sep04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SE1392
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    SE1392
Enzymes [BR:sep01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SE1392
Transfer RNA biogenesis [BR:sep03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    SE1392
 Prokaryotic Type
    SE1392
Mitochondrial biogenesis [BR:sep03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SE1392
Prokaryotic defense system [BR:sep02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   SE1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase DUF2935
Motif
Other DBs
NCBI-GeneID: 1056469
NCBI-ProteinID: NP_764947
UniProt: A0A0H2VGZ2
Position
complement(1428401..1429549)
Genome map
AA seq 382 aa AA seqDB search
MLSVIYLDNAATTKADQDVVDSFVKVNQTLYFNPNSPHHAGVQAEQLLLKAKSEINRILN
LNNQFDIIFTSGATESNNILLKGIAYMKKETANEIITSVLEHPSVLEVMRYLEREKGFKL
KYVDVTKEGKLDTEHLKSLMTDKVGLVTCMYVNNIMGQIQPIEEIANIVKNYPRAHFHVD
AVQALGKVPMQINHIDSLSLSGHKFNGLKGQGLLLLKNIQNIEPIVHGGGQEYGLRSGTI
NLPMAISMVRAIKNAVDQTKELNLRLSNYKNKLLSFLAEYKNVFINSPQNASPHIINIGF
PGVKGEVLVNAFSKQNVMVSTTSACSSKMNKLNEVLLAMEIAESKIEGSIRISLGAHTTE
NDILSFMNAFESVYKEIKELLK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgttatcagtgatttatttagacaatgcagccactaccaaagctgatcaagatgttgtt
gattcattcgtgaaagtgaaccaaacattatacttcaatccaaatagtcctcatcatgca
ggggttcaagctgaacaattattattaaaagcaaaaagtgaaatcaatcgtatattaaac
ttaaataatcagtttgatatcatttttacaagtggcgcaactgaatcgaataatatactg
ctaaaaggtattgcgtatatgaaaaaagaaactgctaatgagattatcacatcagtctta
gaacatccttcagttttggaagtaatgaggtatttggaaagggaaaaaggttttaaatta
aaatacgttgatgtgacaaaagaaggtaagttggacacagaacacttaaaatcattaatg
acagataaagtaggacttgtgacatgtatgtatgtcaataatattatgggacaaattcaa
cctattgaagaaatagcaaatattgtaaaaaattacccacgtgcacactttcatgttgat
gcagtccaggctttaggtaaagtgcctatgcaaattaatcatattgatagtttgagttta
agtggtcataagtttaatggacttaaaggtcagggactactacttttaaaaaatattcaa
aacatagaacctatagtacatggtggtgggcaagaatatgggctacgaagtggtacaatt
aatctaccaatggctatctctatggttagagctataaagaatgcagttgatcaaacaaaa
gagcttaatttacgtttaagcaattataaaaataaattactttcatttttagcagaatac
aaaaatgtatttatcaactctcctcaaaatgcatcacctcatattataaatataggattt
ccaggtgttaagggtgaggtacttgttaatgctttttccaaacaaaacgtaatggtttca
actacaagcgcttgttcttctaagatgaataaattgaatgaggttttacttgcaatggaa
attgcagagtcaaaaatagaaggtagtataagaatttctttaggggcacatacgactgaa
aacgatatattaagttttatgaatgcatttgaatctgtatataaggaaattaaggagctg
ttaaagtaa

DBGET integrated database retrieval system