KEGG   Staphylococcus epidermidis ATCC 12228: SE1539Help
Entry
SE1539            CDS       T00110                                 

Definition
(RefSeq) transposase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5469
Motif
Other DBs
NCBI-GeneID: 1057933
NCBI-ProteinID: NP_765094
UniProt: A0A0H2VHB4
Position
complement(1586509..1586625)
Genome map
AA seq 38 aa AA seqDB search
METSALIPANDISRHVNDIAETIPDTEFDEFRHYRCLI
NT seq 117 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttcagctcttatccccgcgaatgatatttcacgacatgtaaatgatattgca
gaaacaattcccgatactgaattcgatgaattcagacattatcgttgcttaatataa

DBGET integrated database retrieval system