KEGG   Staphylococcus epidermidis ATCC 12228: SE2012Help
Entry
SE2012            CDS       T00110                                 

Definition
(RefSeq) two-component response regulator
  KO
K07705  two-component system, LytTR family, response regulator LytT
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02020  Two-component system
Module
sep_M00492  LytS-LytR two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SE2012
Two-component system [BR:sep02022]
 LytTR family
  LysS-LysR [MD:M00492]
   SE2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytTR Response_reg DUF4760
Motif
Other DBs
NCBI-GeneID: 1055950
NCBI-ProteinID: NP_765567
UniProt: Q8CN55
Position
2051375..2052133
Genome map
AA seq 252 aa AA seqDB search
MKALIVDDEPLARNELQYLLNLNDAIDEIEEAENIEETLEKLLYNTFDLIFLDINLMDES
GIDLAQKINKMKRSPHIIFATAHEKFAVKAFELNATDYILKPFEKERINQAVNKVDMAKD
KSKNKDKTITPKYIDYSDDERAQTHVLPIEVDERIHILNFTDIIALSVNNGITTIDTTKQ
SYETTETLNHYEKKLPSSLFIKIHRATIVNKEHIQTIEHWFNYTYQLTLTHEFKYQVSRS
YMKTFKQQLGLQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttaatcgttgatgatgaaccacttgcaagaaatgaattacaatatctttta
aatcttaatgatgctatagatgaaattgaagaagcagaaaacatagaagaaacattggag
aagttactctacaacacatttgacttaatattcttagatataaatttaatggatgaaagt
ggtattgatttagctcaaaaaattaataaaatgaagcgatcaccacatattatctttgca
accgctcacgagaaatttgcagtcaaagcctttgaattaaatgcaaccgattatatatta
aaaccttttgaaaaagaacgtattaatcaagctgtaaataaggttgacatggctaaagat
aaatcaaaaaacaaagataaaactatcacacctaaatatattgattatagtgatgatgag
cgcgctcaaacacatgtactcccaattgaagtggatgaacgtattcacatcttaaatttc
acagacattatcgcattatctgttaataatgggattacaacgatagatacaacaaaacaa
agttatgaaacgaccgaaacacttaatcattacgagaaaaaactaccttcctctctattt
attaaaatacatcgcgctactatcgttaataaagaacatatccaaacaatagagcattgg
tttaattatacgtatcagctgacgttaacacatgaatttaaatatcaagttagtcgttct
tatatgaagacttttaaacaacaacttggtcttcaataa

DBGET integrated database retrieval system