KEGG   Staphylococcus epidermidis ATCC 12228: SE2154Help
Entry
SE2154            CDS       T00110                                 

Definition
(RefSeq) coenzyme A disulfide reductase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_dim Pyr_redox_3 DAO HI0933_like NAD_binding_9 TrkA_N 3HCDH_N NAD_binding_8 Amino_oxidase NAD_binding_7 UDPG_MGDP_dh_N GIDA AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 1056238
NCBI-ProteinID: NP_765709
UniProt: A0A0H2VKI0
Position
2199852..2201213
Genome map
AA seq 453 aa AA seqDB search
MKYIVVGTSHSGYEVIQTLLKEDENADIQVFESADQPSFLSCGIQSYLEDISSSLDDLHY
ASVDSYKAQGVNIHTNSTVTDLDTDNKTVVVEHQGQTATYSYDKLFLSPGGKPVTPPVDG
IEKYKHVLFMRGRDWANQIKERMKDAKKAVVVGGGYIGIEAAEAFAKADIDTTIVDVADR
ILNTYLDKEFTDILETNAQQHGLHFKGGETVKSISGNQNGEVTTVVTDKNEYDADTVLFA
VGVEPATEWLKDKIDLGKKGIININHQQQTSAKDVYAGGDATLVPFAPVSEDRYIALATN
SRRQGVVAAKNMLGKEMTMPRVSGTSGLQLFDYKFGQTGIHGTEIDNYDGNLGQTYVEEL
IRPQFMQDDTKIHMKIIYDKDTHRILGGQVMSKEDITASINTISVVISAGFTLEQLAVQD
FFFQPDYDRPWHYLNVLAQQALGDTFGSDKMLF
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattgtggtaggtacatctcattcaggatatgaagtgatccaaacattgctt
aaagaagatgaaaatgctgatattcaagtttttgaaagtgcagatcaaccgtccttttta
tcttgtggtattcaaagttatcttgaagacatctcatcatcattagatgatttacattac
gcatcagttgactcttataaggcacaaggtgtaaatattcatacgaatagcacagtcaca
gatttagatactgacaataagactgttgtagttgaacaccaaggtcaaacagcaacttat
tcttatgataaattgttcctaagtcctggtggcaaacctgttacccctccagtcgatgga
attgaaaaatataaacatgtattatttatgcgtggacgtgattgggcaaatcaaattaaa
gaacgcatgaaagatgccaaaaaggctgttgtagtcggaggtggctatatcggtattgaa
gctgctgaagcttttgctaaagcagacatagatactacaatcgtagatgtcgctgatcgt
atattaaacacttacttagataaagaatttacagacatattagaaacaaatgcacagcaa
catggtcttcattttaaaggtggcgaaacagtaaaatcaatttcaggaaatcaaaatggc
gaagtaactactgtagttaccgacaaaaatgaatatgacgcagatactgtcttatttgct
gtaggtgtcgaaccagctaccgagtggctaaaagataaaattgatttaggtaagaaagga
attataaacattaaccaccaacaacaaacatctgctaaagatgtctatgcgggtggcgat
gcgacattagttccttttgcaccagtatctgaggatcgttatattgcattagcaacaaat
tcaagacgtcaaggcgttgtcgcagcaaaaaacatgttgggtaaagaaatgacaatgcca
cgcgtttctggtacttcaggtttacaattatttgattataaatttggacaaactggcatt
cacggtacagaaatcgataattatgatggcaatttaggtcaaacatacgtagaagaattg
attcgtcctcagtttatgcaagatgatacgaaaattcatatgaaaattatttatgataaa
gacactcaccgtatacttggtggtcaagtcatgtcaaaagaagatattactgcttctatt
aacacaatttcagtagtaatatctgctggtttcacacttgaacagctcgctgtccaagat
ttcttcttccaacctgattatgatagaccttggcattatcttaatgtgttagcccaacaa
gcattgggagatacatttggtagcgataagatgttattctaa

DBGET integrated database retrieval system