KEGG   Staphylococcus epidermidis ATCC 12228: SE2203Help
Entry
SE2203            CDS       T00110                                 

Definition
(RefSeq) transposase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1_6
Motif
Other DBs
NCBI-GeneID: 1056475
NCBI-ProteinID: NP_765758
UniProt: A0A0H2VIH4
Position
2256022..2256189
Genome map
AA seq 55 aa AA seqDB search
MKNYSHRKLAVEPIWGFMKVILGFTQVSARSINKVKGKKFLLMVLNIKKNSDSEI
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactatagtcatagaaaattggctgtagaacctatttggggatttatgaaggtt
attttgggtttcactcaagtgtcagctcgatctataaataaagtcaaagggaaaaaattt
ttattaatggtgcttaatattaagaaaaatagcgactcagagatttga

DBGET integrated database retrieval system