KEGG   Staphylococcus epidermidis ATCC 12228: SE2255Help
Entry
SE2255            CDS       T00110                                 

Definition
(RefSeq) transport system protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:3.6.3.28]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02010  ABC transporters
Module
sep_M00223  Phosphonate transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE2255
Enzymes [BR:sep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.28  phosphonate-transporting ATPase
     SE2255
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphonate transporter [MD:M00223] [OT]
    SE2255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_22 AAA_30 SMC_N AAA_29 AAA_27 AAA_33 MMR_HSR1 AAA_23 AAA_16 PEPCK_ATP AAA_18 AAA_25
Motif
Other DBs
NCBI-GeneID: 1057565
NCBI-ProteinID: NP_765810
UniProt: Q8CMU4
Position
complement(2320349..2321122)
Genome map
AA seq 257 aa AA seqDB search
MSQIEFKDVSKVYPNGHVGLKDINLNIEKGDFAVIVGLSGAGKSTLLRSVNRLHDISKGD
ITIEGQSITKARGKKLLEMRRSIGMIFQHFNLVKRSTVLRNVLSGRVGYHPTWKMILGLF
PKEDKVKALDALERVNILDKYDQRSDQLSGGQQQRISIARALCQEPTIILADEPVASLDP
LTTKQVMDDLKKINEELGITILINLHFVDLAKEYGSRIIGLRAGELVYDGPASEANDEVF
NHIYGRSIKDDEKLGVE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatcgaatttaaggatgttagtaaagtgtatccaaatgggcatgtgggatta
aaagatattaacttaaatatagaaaaaggtgattttgcagttattgttggattgtctgga
gcaggtaaatcaacattactacgatcggttaatcggctacatgatatttccaaaggtgat
attactatcgaaggtcagtcaataactaaagcacgtggtaaaaaattattagaaatgcgt
cgaagtataggtatgatttttcaacattttaacttagttaagcgttcaacagtgcttaga
aatgttttgagtggcagggtaggataccatcctacttggaaaatgatacttggtcttttt
cctaaagaagataaagtcaaggcattggatgccttagaacgtgtaaatattttagataaa
tatgaccaacgctctgaccagttgtcaggtggtcaacaacaacgtatatcaatagctaga
gcgttatgtcaggaaccaaccattatattagcagacgaaccagttgcttcattagatcca
ttaactacaaaacaagtgatggatgacttaaagaaaatcaatgaagaacttggtattact
attttaattaatttacactttgttgatttggcaaaggaatacggatcgagaataattggt
ttaagagcgggagagctcgtttatgatggacccgcgtctgaggcaaatgacgaagtattt
aatcatatatacggtcgctctattaaggacgatgaaaaattaggggtggaataa

DBGET integrated database retrieval system