KEGG   Staphylococcus epidermidis ATCC 12228: SE2308Help
Entry
SE2308            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_9 FR47 Acetyltransf_CG NMT Acetyltransf_4
Motif
Other DBs
NCBI-GeneID: 1055685
NCBI-ProteinID: NP_765863
UniProt: A0A0H2VIW8
Position
complement(2385683..2386213)
Genome map
AA seq 176 aa AA seqDB search
MHIYLSTLTEVDYETSLNSIENNYNLNPESSWQDRARVKNLRKLESYNYELEVIAKNELN
EVIGHVVLAEVKLSSKNKKAIALAIGALSVDKSIRNQGLGQALLKAVEERAKEQGYCAIF
VNNHPQYFEKSDYEAAHLYNIHIEEKRNHQSLLVKFLKPVQNEWSGMTVYYPEVLD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcatatttatttaagtactttaacagaggtcgattatgaaacgtcactaaatagtata
gaaaataattataatctaaatccagaatccagttggcaagatcgagcgcgcgttaaaaat
ctaagaaaacttgaaagctacaattatgaattagaagttatagctaagaatgaattgaat
gaagttataggtcacgttgtgttagcagaggttaagttgtcgtctaaaaacaaaaaagcg
atagcgttagccattggtgcactgtcagtagataaatctattcgaaaccaaggtttaggt
caagccctgttaaaagctgtagaagaacgtgctaaagaacaaggctattgtgctattttt
gtaaataatcatcctcagtactttgagaaatctgattatgaagcagcccatttatataat
atacatatagaagaaaaacgaaatcatcaatcattattagtaaaatttctaaaaccagtt
caaaatgaatggtctggaatgacggtgtattatccggaagtactggattga

DBGET integrated database retrieval system